SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009702 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009702
Domain Number 1 Region: 662-784,950-1094
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.06e-23
Family p120GAP domain-like 0.044
Further Details:      
 
Domain Number 2 Region: 66-105
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000785
Family Plexin repeat 0.004
Further Details:      
 
Domain Number 3 Region: 1-64
Classification Level Classification E-value
Superfamily Sema domain 0.0000116
Family Sema domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009702   Gene: ENSTNIG00000006905   Transcript: ENSTNIT00000009878
Sequence length 1166
Comment pep:known_by_projection chromosome:TETRAODON8:19:6544322:6553387:1 gene:ENSTNIG00000006905 transcript:ENSTNIT00000009878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFFIGTGDGQLIKLAVDRHYSTACPKVLYKADYDRRVFPKISLDQVDQKHVYLAFLHQIR
RVPVSNCGSYTSMRDCWSAQDPYCVWCSSKNRRCTFEEACSNSTWLSIPEESRQRMVSYQ
VMKDKDKVLLLGFPISLKHSKPVFLSFSINFVLLKSDVSLEFPQCTCTIPRDRLPDAGLQ
VKVDVTLGTTHLSERVNIFNCTNISGPPTPVLCRRCLQVGCGWSSSGCSWANAGERNESV
CQKEDSGNITVSHRRRSPSEDQPALARFKPVFPSDVSFYGKNNAVLSGQNLGAVTRVRIQ
ADGDCKSQEVPVWGNTGSSLTFHIPSTDSKGIVQACVLLEDGSCHGNTTITYQSVPSCTG
IAPNSSWSSGDRLITLTGSHLEFVDGVLHQHNRSVIQPSANRSVQVSPADRSWERSVLTY
KTPEGSGVSRTEVRLRVANQTLPCCDLTYHPDPEFGSFTTLKTKDSIRVHHPVQKKADEL
QVSLAELSVWGVHEGKEHPCVMETTESTDQIIICEIKTQQHIEFMELKVKGRQIRFGQRT
VTLTLQAARWPLILLVLLLIPCIVVCVAVVYGKKQKKLTAQMNKRMEELELDVRNDIRQG
FVDLQTEKADLMENVGTIPFLDYKHFASRIFFPENEQLMKACVRDIGQDGRQNQLDECCL
ALSQLLQDRLFLTSMVHALEEQKSFTIKDKCALASLLTVALHSKLLYLTAVMEALLKDLM
QQNSGAQPKLLLRRTEFTVEKLLTNWMSICLYGFLRESVGQQLFLMVSALTQQIAKGPVD
CVTEKALYTLSEDWLLWQAQDFSSVRLKVLFAVGTDGEVSEPLEVGALSCDTVEQVKEKI
LASFRAKFGFSYGPPLRELSIEYEKNGSFVPLQETDASSQVIGEVTMLNTLKHYKVPDGA
TLKVLSHMYVYLDDENFSGKYFHLIDADVDEAQIKNPERKKFELKEVHLTKLLSTKVAVH
SFVENLFRSIWGTPHAKAPHAVKYFFDFLDWQADVLRITDPDVLHIWKTNSLPLRFWVNI
IKNPQFVFDMVKTPNLDGCLSVIAQAFMDSFSLSETQLGKHAPTNKLLYARDIPKFKQEV
KAYYRQVRDQQPVTAPEFQDFLLQESKKHQNEFNEAVALRELYKFIQRYFTEIKKKMEEN
GVPGELTEQLHHVRNSFEGLKSCSWN
Download sequence
Identical sequences H3CN71
ENSTNIP00000009702 99883.ENSTNIP00000009702 ENSTNIP00000009702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]