SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009710 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009710
Domain Number 1 Region: 390-567
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.29e-44
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.073
Further Details:      
 
Domain Number 2 Region: 256-352
Classification Level Classification E-value
Superfamily WWE domain 0.000000000000327
Family WWE domain 0.0056
Further Details:      
 
Domain Number 3 Region: 186-211
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000628
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009710   Gene: ENSTNIG00000006913   Transcript: ENSTNIT00000009886
Sequence length 567
Comment pep:known_by_projection chromosome:TETRAODON8:19:6405406:6409217:-1 gene:ENSTNIG00000006913 transcript:ENSTNIT00000009886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPGSCRGLHLCKNFLFSGSCQYTPTRRGCLYSHTLDSAHNGQILKEHKLEHLSRAELCTL
LLQSDDRLLPRICHDYNTGDGVFGGCQEGLACKRLHICERYLNRNCGCSRNHNFGVPHTL
SILQGVPRGLGLKSVYANIQALKYHDIQSNKARGGNQKLRGGNRGRRGRGRGPQPSHPQK
TSAPTEDKTEICKYFLRGHCKHQERCLKAHDKMPYRWETNRIGQWTPLPRNEAIEKDFCD
PKQTYSSSSFPCINFDTMTRGPDKVRRIDAGSTEWLWYWEDEFGKWNMYASPDGGHKQAD
VDSCFLEQRFLADPNDGVIFRANSQKYSLSFRDMIQKNTYYGTKKLVRRRPRFVSAADVQ
EGRLSKRGERAHFSAVPNHWDKTQLPQTGYKRVPLMASSEEYQEVVALFRKTMAFHILKV
ERIQNKTLWDFFQLQKTQMKNSNGGRPVLEMKLFHGTDNQYVDTICHTNFDWRLCGSHGT
AFGKGSYFAQNAKYSHSYTSDSNVRSMFVVRLLVGEYTKGSPEYRRPPSKDGGDINFYDS
CVDDVHTPSIYVVFDKHQIYPEYLLQY
Download sequence
Identical sequences H3CN79
ENSTNIP00000009710 99883.ENSTNIP00000009710 ENSTNIP00000009710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]