SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009726 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009726
Domain Number 1 Region: 598-715
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-30
Family Cadherin 0.00098
Further Details:      
 
Domain Number 2 Region: 267-388
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-29
Family Cadherin 0.00082
Further Details:      
 
Domain Number 3 Region: 500-602
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-28
Family Cadherin 0.00046
Further Details:      
 
Domain Number 4 Region: 707-810
Classification Level Classification E-value
Superfamily Cadherin-like 6.16e-21
Family Cadherin 0.0038
Further Details:      
 
Domain Number 5 Region: 136-272
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-17
Family Cadherin 0.0032
Further Details:      
 
Domain Number 6 Region: 380-498
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-16
Family Cadherin 0.0059
Further Details:      
 
Domain Number 7 Region: 33-101
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000814
Family Cadherin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009726   Gene: ENSTNIG00000006929   Transcript: ENSTNIT00000009902
Sequence length 1040
Comment pep:known_by_projection chromosome:TETRAODON8:20:1107349:1111747:-1 gene:ENSTNIG00000006929 transcript:ENSTNIT00000009902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDERNTAADRGSCLFCSVLVLQLLHQPAAKQVLRYRLAEEGPADVRVGNVAADLGIVAV
SGEVTFTLESGSEFFKIDNITGELSTNERRIDREKLQQCQMIFDENECFIDFEVSVIGPA
QSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERY
ELIQDGGENSRRLGSPGDSYSGKRRFEEGASRSSVFELQVADTTDGEKLPQLIIKGALDR
EQRDSYLTLRVRDGGDPPRSSQAILRVMITDVNDNSPRFEKSVYEADLPENSPPGSPILQ
LKAADADVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARD
RGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGTANVAEDVVVDTPIALVQVSD
RDQGQNGVVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYEATQEYNVVIVAVD
SGSPSLASNNSLLVKVGDTNDNPPIFGQNVVEVSFPENNGPGERVTTVTAIDADSGKNAE
IAYSLDSSVNGIFSIDADTGDIRVNAVLDREHTERYEFRVIAKDKGVNTLQGSATVVVLV
SDKNDNEPKFMQDVFTFYVKENLEPNSPVGMVTVIDADKGHNAEMSLFIEEEEEIFSIEN
ETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPKNSS
YTLLPPSSNIRTLVRKVVATDTDTGINADLNYSIIGGNPFKLFDIDGGTGVILLMGKLEQ
KHYGLHRLVVQVNDSGQPSQSTTTLVHVYVNETLSNSTVVEAQVAKSLSTSLNTNIAGDP
NYDLSKQRLSIAIGVISGIMTVILIILVVVMARYCRPKNKNGYEAGKKDHEDFFTPQQHD
KSKKPKKDKKKQKSKQPLYSSIVTVEASKPNGQRYDGVSEKLSDSPGMGRYRSVNGGPGS
PDLARHYKSSSPLPTVQLHPQSPTAGKKHQAVQDLPPANTFVGTGDNISLGSDHCSEYSS
QTINKYNKQIPSHQYFCLFT
Download sequence
Identical sequences H3CN95
99883.ENSTNIP00000009726 ENSTNIP00000009726 ENSTNIP00000009726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]