SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009793 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009793
Domain Number 1 Region: 75-201
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-28
Family Cadherin 0.00042
Further Details:      
 
Domain Number 2 Region: 300-419
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-23
Family Cadherin 0.005
Further Details:      
 
Domain Number 3 Region: 189-302
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-19
Family Cadherin 0.0016
Further Details:      
 
Domain Number 4 Region: 6-87
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-16
Family Cadherin 0.0067
Further Details:      
 
Domain Number 5 Region: 409-519
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000458
Family Cadherin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009793   Gene: ENSTNIG00000006994   Transcript: ENSTNIT00000009971
Sequence length 724
Comment pep:known_by_projection chromosome:TETRAODON8:1:11272965:11280949:-1 gene:ENSTNIG00000006994 transcript:ENSTNIT00000009971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSQLHTDMDRGDGHTKYMLEGEGVGSVFVIDSNTGNIHVTKALDREEKDQYRLIATATD
RQTGRALEPSSEFIIRVQDINDNPPVFPNEPYIAMVPEMANIGTSIIQVTARDADDPTYG
NSARLVYAITQGQDYFSVDAQTGTLRTAVPDMDRESRDEYLVVLQAKDMGGHLGGLSGTT
TVTVKLTDVNDNPPHFRRSAWSFSVSELAAPGVEVGRLTASDPDLGENALLEFTIMDSEE
AEIFNLTKKDKEAVIVLSKLLDYEACNSYTFSVEVSNPIVDPRYLKKGPFKDQTTVRVMV
LNADEPPQFSQVRYHLDVSENCPPVCSVGRVYAVDPDTGQSSNIRYSIDPQSDPEALFRI
ASDTGFISTVMELDREVEQWHNITVIAAQRDNPNLVSRVVVAIETLDQNDNAPELDRQYT
TSVCDSSAPGQVVQVLRAIDRDQGGQENQVHFSIPPESSSALNLSVRESGGVTASLVLQS
ALEPLPGFSSSLLTLYVPVVLRDGASGLTNTGTVTVTICPCLRGGMQTEDRVPSPSTSLI
FSLVTLLSMLACVTTLLVVCALSLSLRHQKRDSHSPFEEDDVRENIISYDDEGGGEADTA
AFDITALQSMHRIQHMHNSRNILPSWAFGGRSAVNAADTGSDQRKDLLNIRLDQVTFDLS
QPPYDSLQTYEFEGRDSRAESLSSLESDGEKDNGRVVGGMEELNQKFQRLVEIIGGESLD
EITA
Download sequence
Identical sequences H3CNG2
99883.ENSTNIP00000009793 ENSTNIP00000000990 ENSTNIP00000009793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]