SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009813 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009813
Domain Number 1 Region: 217-339
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-31
Family Cadherin 0.00074
Further Details:      
 
Domain Number 2 Region: 430-553
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 114-221
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-24
Family Cadherin 0.0045
Further Details:      
 
Domain Number 4 Region: 330-434
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.0026
Further Details:      
 
Domain Number 5 Region: 546-656
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-19
Family Cadherin 0.0024
Further Details:      
 
Domain Number 6 Region: 16-111
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000171
Family Cadherin 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009813   Gene: ENSTNIG00000007013   Transcript: ENSTNIT00000009991
Sequence length 1004
Comment pep:novel chromosome:TETRAODON8:Un_random:88731738:88741923:1 gene:ENSTNIG00000007013 transcript:ENSTNIT00000009991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVFVLLLCITDGALSQIRYSVPEEADHGTLVGNIAEDLGLDLTKLASRRFQVVPSSRTP
YLEVNLENGVLFVNEKIDREQICKQTATCQLNMEVFLENPLELFRVEIEVVDINDNPPSF
PETDITVEISESATPGTRFPLESAFDPDVGSNALRTYDITTNNYFYIDVQTQTDGNKFAE
LVLEKPLDREQQAAHRYVLTAVDGGQPPRTGTALLVVRVLDSNDNVPVFDQSVYTVSLSE
NAPVGTLVIQLNATDMDEGLNGEIVYSFSNHISNRVKDLFSIDPRTGRIEVRGEVDFEES
SLYQIFVQAKDLGPNAIPTHCKVLVKVTDVNDNAPEITFSTVTESVSEKAAPGTVIALLS
VTDKDAEENGQIHVELLGEVPFKLKSSFRNYFTIVTDGPLNREQADSYSVTVVARDKGSP
SLATSKSIRVQVSDENDNSPTFTQSIYDVYVTENNVPGAYIHAVTALDPDAGQNALISYS
ILECNIQGMSVKTYVSINEETGYLYALRSFDYELLKDFTFMVQARDAGTPPLTSNATIKV
IIVDQNDNPPLVLAPLGKNGTAREPLPRSAEPGYLVTRIVAMDADDGENARLSYSILRGN
ENGMFRMDWRTGELRTARRVSAKRDLHQLYDLMIEVRDHGQPPLSSSASIQVMLVDSVIE
GRGSGDRRSTTKAKDGSLDLTLILIIALGSVSFIFLLVMIVLAVRCQKDKKLNIYTCLTS
ECCMGCSSCCSRQGRARKKKLSKSDIMLVQSTGNVSGAGTAQVPVEESGSFGSHHQNQNY
CYQVCLTPESAKTDLMFLKPCSPSRSTDTDHNPCGAIVTGYTDQQPDIISNGSILSNETK
HQRTELNYLVDRPRRVNSSAFQEADLVSSKDSGHGDSEQGDSDHDATNRGHSSGTDLFSN
CTEECKALGHSDRCWMPSFMPSDGRQGPDYRSNLHVPGMDSVPDTEVFNCPEQTADKSFS
TFGKAMPLRHHHGSIDRKELETFFASSRATYKPAFLYLTRKRFC
Download sequence
Identical sequences H3CNI1
ENSTNIP00000009813 99883.ENSTNIP00000009813 ENSTNIP00000009813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]