SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009851 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009851
Domain Number 1 Region: 55-316
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.56e-59
Family Ankyrin repeat 0.00000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009851   Gene: ENSTNIG00000007051   Transcript: ENSTNIT00000010029
Sequence length 553
Comment pep:known_by_projection chromosome:TETRAODON8:11:3754024:3778259:-1 gene:ENSTNIG00000007051 transcript:ENSTNIT00000010029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANHLELIQELQQLDKAPSLERLRAAQKRRTQQLKRWAVYEKEMQSKKRKADKKARSANS
LQQDHKKHVSFAASVALLEASARNDPDEVRYLLTNNVSADLCNEDGLTALHQCCIDNYEE
MVKILLDRGANVNAQDNELWTPLHAAATCGHAGLVIILIAYGADLLAVNSDGNMPYDLCE
DDPTLDIIETAMANRGITQEMINETRASTERRMLRDIQELLKQGEEVNQQDSQGATLLHV
AAANGYVQATELLLEGGARMDLRDSDGWQALHAAACWGQMHVAELLVSHGASLNAKTFLE
ETPIDLCEDEEFRAILLDLKHKHDTIMKSQLKHKTSLCRRTSSAGSRGKVVRRASLSDRH
NLCRKEYETEAIVWRGGREEEPEKERESDQENNQTVQDSKFCNPKSFFVPQVKALTSVEQ
PDQPRLQTILKDSAGTQNGLISTATSTPAPLPSNGSVPTPEMGSQPPQEEAWPKERAQTL
SELKKQRAAAKLLNHPYTPSLMPNPPRRTPACPLVSSNGSAVYYTPASGDPPLLKLKQPE
EEQPKAQTCCCVS
Download sequence
Identical sequences H3CNL9
ENSTNIP00000009851 ENSTNIP00000009851 99883.ENSTNIP00000009851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]