SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009870 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009870
Domain Number 1 Region: 140-248
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-25
Family Cadherin 0.00026
Further Details:      
 
Domain Number 2 Region: 244-343
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-20
Family Cadherin 0.00083
Further Details:      
 
Domain Number 3 Region: 358-486
Classification Level Classification E-value
Superfamily Cadherin-like 3.29e-20
Family Cadherin 0.01
Further Details:      
 
Domain Number 4 Region: 55-147
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000196
Family Cadherin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009870   Gene: ENSTNIG00000007069   Transcript: ENSTNIT00000010048
Sequence length 777
Comment pep:known_by_projection chromosome:TETRAODON8:11:3211439:3260373:-1 gene:ENSTNIG00000007069 transcript:ENSTNIT00000010048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALGLLSFCSFDSCKASRTSSSTLGGRREDQGPSSLERVKRGWVWNQFFVVEEYTGTEPL
YVGKIHTDSDEGEGNIKYSISGEGAGSIFIIDELTGDIHATERLDREEKAFYTLRAQARD
RLSNDPLEPESEFVIKVQDINDSEPKFLEGPYIGSVAELSPIGTSVMKVTASDADDPTYG
SSARVVYSVLDGEKFFTVDRHTGIIMTAVADLDRETQDRYELVVKATDMAGQMGGLSGST
TVTIVITDVNDNPPRFPQKMYQFSVSEGAAVGTAVGRVIATDADMGENTDMTYLIKDGGE
LFKVTTDAETQEAVVSIKKPLDFENKRTHNVVVEAVNKHVDPRFVDLGSFRDQTIVRVSV
SDIDEPPIFQPAEGTIMEVQEDTKVGALVGVVAARDPDVKNKPVRFSIDRATDQDMIFHI
DPDSGAITLGKILDRETAGWHNITVKAVEADNHTMVSHTLVSIRILDVNDNPPELATPYE
ASICEDAKPGQAVVLVSSVDHISPSIPHHFHYISMMTKCSNSRKPPLKKKKKNTRASMKH
KRIILRQQQLVHFLLLVSLSSPKNKSNYGLAPMLSNCTNNSIIATSVYSGLIAVPSFKED
SWYSLLACTLTTVLVFVLLILTLKRHRKGQRIAEDEEDMRDNVIKYNDEGGGEQDTQAYD
MSALRNLYDFPEAKSCDSGPDIRCLPQWIQANRADFSLFKGYIRKKVEQADADLSVPPYD
SFQTYAFEGTSSPALSLSSIHTLSTTSEQDFSYLSDWGPRFRQLAGYYAPGKQEEEG
Download sequence
Identical sequences H3CNN7
ENSTNIP00000009870 ENSTNIP00000009870 99883.ENSTNIP00000009870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]