SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009879 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009879
Domain Number 1 Region: 131-514
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.93e-98
Family Ankyrin repeat 0.00000262
Further Details:      
 
Domain Number 2 Region: 636-965
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.14e-57
Family Ankyrin repeat 0.0000235
Further Details:      
 
Domain Number 3 Region: 528-678
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.04e-30
Family Ankyrin repeat 0.00047
Further Details:      
 
Domain Number 4 Region: 5-110
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000087
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009879   Gene: ENSTNIG00000007078   Transcript: ENSTNIT00000010057
Sequence length 975
Comment pep:known_by_projection chromosome:TETRAODON8:11:2970266:2984491:1 gene:ENSTNIG00000007078 transcript:ENSTNIT00000010057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRNIKDQSPLVQAIFSRDTEEVTFLLDHNQDASSLDQEQSTPLHAASYLGDVHIMELI
IASGRKLDISHHRHTIFIHQIISLSYGCSLFICIFTGADVNAKGLSLLTPYIEQRVASEV
CLEVVNSQEGTPLDHTAKSGHEKMVSLLLSKGANVNANDKKERKPIHWAAYHGHLEVVKL
LTSQGANVKCKDKQGYTPLHAAAVSGQLDVIKYLLRVVSEIDDSNAYGNTALHMACYTGQ
DTVANELVNCGANINRPNRHGSTPLHLAAASSSGVLCLELLVNNGADVTMQNKEGKSPLH
VAAMHGRFTGSQILIQNGGEIDCVDIFGNTPLHVAARYGQELLISTLLSNGANKSRRRID
GMLPVHLAALYGFPDCCRKLLSNVECDINVLDEYGRTCLHAAASGGNIDCLNLLLNCGAD
LDIKDHLGRSPLHYAAANKNSQCVVSLVRAGAEVNERDLTGCSPLHCAAASFNSFGCLDY
LLDSGANPTLRNSKGYSAVHYAAAYGNKQHLELVCEFLSLLQLLEISFNCLEEVESNIPV
SPLHLAAYYGHCEALRLLCETLVSLDVRDIEGRSALHLAARRGFAPCVEVLLKHQASYTL
KEHRHKWTALHAAAAEGQMDCLLLLVNQEHSADIIDCPDTKGQTALMLAALGGHIDCVHI
LLEKGAKADAADTKGFTALHRAAMLGCEGCVSALLEHGASALYRDSQGRTPLHLAASLGH
TELLQTLLKAAMKSDPLDSMLDYRGYMPVHWAAYHGHEDCLCILLEKKLFNYKEGNLFTP
LHCALVNGHGVSAGLLLKAVGPDIVNARDAKGSRTPLHSAAYSGKVAGLQLVIDQGAEVN
SVDQRGCSALMVAAERGQTRAVEFLLHKAKPDLSLVDISNNTALHLACSKGHEMCALLIL
GEISDCSLINATNGALQMPLHIAARNGLATVVQVLLSRGAAVMAVDEEGHTPALACAPNK
NVAECLALILSTMKP
Download sequence
Identical sequences H3CNP6
ENSTNIP00000009879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]