SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009889 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009889
Domain Number 1 Region: 125-265
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-30
Family Cadherin 0.0000104
Further Details:      
 
Domain Number 2 Region: 356-480
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-25
Family Cadherin 0.00076
Further Details:      
 
Domain Number 3 Region: 245-361
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-19
Family Cadherin 0.00028
Further Details:      
 
Domain Number 4 Region: 34-129
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000236
Family Cadherin 0.0000221
Further Details:      
 
Domain Number 5 Region: 491-573
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000246
Family Cadherin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009889   Gene: ENSTNIG00000007088   Transcript: ENSTNIT00000010067
Sequence length 773
Comment pep:known_by_projection chromosome:TETRAODON8:11:2738881:2772402:-1 gene:ENSTNIG00000007088 transcript:ENSTNIT00000010067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWDSQPKVIKFSRKHQRGSAVNGLRRQKRDWVIPPINVPENSRGPFPHMLVRIRSDQDKD
VGIRYSITGAGADQPPSGIYNIDPISGNMFVTQPLDREDRASFHLRAHAVDMNGNQVENP
IELYIYVIDMNDNRPEFQNQVYNGSVAEGSKPGSSVMQVTATDSDDSTTANGMVRYRILS
QTPHNPIPNMFTINSETGDIVTVSAGLDREKVSQYTIIVQATDMEGNLNFGLSNTATALI
SITDINDNPPELTVRTFSGEVPENKVNVVVTNLTVVDRDQPHSPNWNAVYRIVGGDPTGH
FTIHTNPITNEGMLTVIKPVDFEMNRAFGLTVVVSNQAHLASGIQSSLQSTAGVTISVQD
VNEPPVFPVNPKMIRFEEGVPAGTTLTVFAAQDPDRFIHQIVRYSKLSDPANWLKINRTN
GQITTMALLDRESMFVKNNVYEATFLAFDNGSPPASGTGTLQIYLIDVNDNAPELIPREA
QLCDRPRPNSRINITAADGDADPNVGPFVFELPSFPASVRRNWTISRLNGDYAQLKLRLS
YLEAGVYDIPVIVSDSGNHRSAIRVKVCPCDDNGDCSATGAVAAAGLGTGAIIAILISII
ILLSMVLLFVVWMKRREKERQAKPLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQP
ESLDHIINKPAGVRRVDERPVIAESQYPVRSSLPHPGDIGEFINDGLRAADNDPTAPPYD
SLLVFDYEGSGSTAGSVSSLNSISSGDQEYDYLNDWGPRFKKLADLYGGGDDD
Download sequence
Identical sequences H3CNQ6
ENSTNIP00000009889 ENSTNIP00000009889 99883.ENSTNIP00000009889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]