SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009911 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009911
Domain Number 1 Region: 489-745
Classification Level Classification E-value
Superfamily NHL repeat 9.29e-46
Family NHL repeat 0.0000117
Further Details:      
 
Domain Number 2 Region: 330-425
Classification Level Classification E-value
Superfamily E set domains 6.67e-20
Family Filamin repeat (rod domain) 0.0026
Further Details:      
 
Domain Number 3 Region: 26-73
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000144
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 4 Region: 117-176
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000572
Family B-box zinc-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009911   Gene: ENSTNIG00000007110   Transcript: ENSTNIT00000010089
Sequence length 747
Comment pep:known_by_projection chromosome:TETRAODON8:18:8986378:8990575:1 gene:ENSTNIG00000007110 transcript:ENSTNIT00000010089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRSRMASEGATLPSPVVRQIDKQFLICSICLDRYENPKVLPCLHSFCERCLQNYIPAHSL
TLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSCSQEAAALNSVADAAAGQLL
SCPNHGGNVMEFYCPHCETAMCQECTNGEHGEHPTVPLKDVVEQHKASLQEQLGAVKRRL
PEIHSGLQTLSDILQQLTSQKSSIEDDIHSTFEELQKTLNVRKSLLLMELEVSYGLKQKV
LQAQLDTLLQGEEGIRSTCDFTEQALSRGTDAEVLLVKKQMSDRLVGLATQDLPLQPGEN
DQLDFLVETEGLKKSIHNLGTIVTTNAVASETVATGEGLRHCVVGVPTSVTITTKDKDSE
LCKMGNAVITAELSSSDGSKGEGEILDNKNGTYEYLFTAPKEGTFNLSLRLYEQHIKGSP
FRIKVSKPIDVTATTDGVKKRLKSPSSGHIKQRAIKRPASMYSIGRRKENPIEDDLIFRI
GTKGRNKGEFTNLQGVAASQGKVLIADSNNQCVQVFSNDGQFRMRFGIRGRTPGQLQRPT
GVAVHPNGDIIIADYDNKWVSIFSSEGKFKNKIGSGKLMGPKGVSVDRNGHVIVVDNKSC
CVFIFQLNGKLVTRFGNRGNGDRQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNTDGEFLL
KFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSRIQVFDSSGSFLLYVNTSADPLYGPQ
GLALTSDGHVVVADSGNHCFKIYRYLQ
Download sequence
Identical sequences H3CNS8
ENSTNIP00000009911 99883.ENSTNIP00000009911 ENSTNIP00000009911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]