SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009917 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009917
Domain Number 1 Region: 196-317
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-32
Family Cadherin 0.0022
Further Details:      
 
Domain Number 2 Region: 1048-1165
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-31
Family Cadherin 0.00095
Further Details:      
 
Domain Number 3 Region: 2111-2235
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-30
Family Cadherin 0.00082
Further Details:      
 
Domain Number 4 Region: 1807-1912
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-30
Family Cadherin 0.00049
Further Details:      
 
Domain Number 5 Region: 1597-1701
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-30
Family Cadherin 0.00034
Further Details:      
 
Domain Number 6 Region: 419-522
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-28
Family Cadherin 0.00098
Further Details:      
 
Domain Number 7 Region: 1703-1813
Classification Level Classification E-value
Superfamily Cadherin-like 7e-28
Family Cadherin 0.00051
Further Details:      
 
Domain Number 8 Region: 2543-2649
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-28
Family Cadherin 0.0016
Further Details:      
 
Domain Number 9 Region: 1493-1596
Classification Level Classification E-value
Superfamily Cadherin-like 9.95e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 625-749
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-23
Family Cadherin 0.0027
Further Details:      
 
Domain Number 11 Region: 2316-2419
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-23
Family Cadherin 0.0019
Further Details:      
 
Domain Number 12 Region: 522-629
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 13 Region: 833-939
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 14 Region: 1157-1264
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-21
Family Cadherin 0.0028
Further Details:      
 
Domain Number 15 Region: 1907-2015
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-21
Family Cadherin 0.0024
Further Details:      
 
Domain Number 16 Region: 2427-2549
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-21
Family Cadherin 0.0033
Further Details:      
 
Domain Number 17 Region: 2221-2320
Classification Level Classification E-value
Superfamily Cadherin-like 8.11e-21
Family Cadherin 0.0023
Further Details:      
 
Domain Number 18 Region: 2651-2760
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-20
Family Cadherin 0.0024
Further Details:      
 
Domain Number 19 Region: 1373-1499
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-19
Family Cadherin 0.0033
Further Details:      
 
Domain Number 20 Region: 740-845
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-19
Family Cadherin 0.0055
Further Details:      
 
Domain Number 21 Region: 88-200
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-19
Family Cadherin 0.0027
Further Details:      
 
Domain Number 22 Region: 2019-2123
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-16
Family Cadherin 0.0019
Further Details:      
 
Domain Number 23 Region: 2758-2868
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000214
Family Cadherin 0.0043
Further Details:      
 
Domain Number 24 Region: 1288-1385
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000814
Family Cadherin 0.0059
Further Details:      
 
Domain Number 25 Region: 308-416
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000137
Family Cadherin 0.0035
Further Details:      
 
Domain Number 26 Region: 950-1060
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000842
Family Cadherin 0.0069
Further Details:      
 
Domain Number 27 Region: 37-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000141
Family Cadherin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009917   Gene: ENSTNIG00000007115   Transcript: ENSTNIT00000010095
Sequence length 3199
Comment pep:known_by_projection chromosome:TETRAODON8:18:8909306:8926265:1 gene:ENSTNIG00000007115 transcript:ENSTNIT00000010095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLTLSVKEGLPAGTIVGDLGAVLSAPSTGFFISESRDSDVFRDLEIDADTGLISTAVVLD
RESRRQYDFVAATPTGEMIKVRIEVKDVNDHSPVFPSEGLNLEISEVSPPGSRFKLEGAK
DEDEDEFGTQGYRIRESEMEERFHLDHHRSGSGQHLSLDLVLMSRLDREEQDFYSLTIEA
FDGGVPPRTGTLQLRIHVLDENDNPPVFNQTEYHASVPEDAPLMSPVCQVHATDLDLGDN
GRITYEINRRQSDPDRVFSINRTSGVVYVNKPLDYEAQAFHELIVSATDNGAQPEHSSTF
VGVRVLNINDHSPSISVLFLSETGDAAVSEAAGLGDFVARISVSDPDFQEERVAVTLEGD
DGKFTLKQTADFLYALYVSADLDREEKDLYELKVRASDLGSPPLSSEVVFLLRVTDANDC
HPQFEKDAYTVSVPEDVPQGSSLIQLQARDADEGPNGAVRYSILRSNQDRLVSIEPESGL
VATAAPLDRESLEQLWFLVVAADGGEPSLSSTATVTVQVLDVNDNEPVFQRQLYGASVPE
HSAVGSCFLQVVATDADSPAFGTLLYSLSDGFDGQDQHPLFHVHPQSGELCVSQDIDRDS
GQTVHDLLIRAEDPGGLSAQTYVHVEVEDLNDNAPVFNPDEYTVSISGHAQPGAEVLNVI
ATDRDSGRFGQVTYGIIPGDMSSLFDVDPQTGTLTLTSPLTDLGAASLQLLLTAQDGEGV
MSAKPAVVTVHVLHSARAPAVFHQSRYTFTVAEDATPGTTVGTVEAVTPAGFSASVSYRI
SSGDPQGFFSIHPRSGVISSTKPLDHELQPNVLLVIQSYSDASPVYSTTQVNIAVTDVND
NAPVFLRASDAVSVSQNVLPGTVLYIAHAHDADSGSNGRVRYRLRNDRFGTFGIDRNLGT
VTLIQSLLGSRQQSYHLEVVAEDGGEPAQSSGLSLSVSVDRSAAEDSLAFETLVYQVEIG
EGYRKDSRVIQVRAHRGRGSRLSSSGLAYALETEAGFPPAPFRIHPKSGWLFAHSLDYET
QSAFRFRVLASAAEPSLANTTATAAVTVSVLDVNDNAPVFSRDLYYFTVSEAPSPQGLVG
TVSAADKDSGRNAQLSYILLSDGKFFRINAKTGEIINWVALNREHHSQHTLKVMVTDQGH
PRLNATATVHILVTDTNDNTPQFMHLPASKEVNVQIWAEIPAGSLVANMFAKDLDAGENG
TVTFSLASEDEGEPPHFEIDGETGNIRTTEHFTRNTRPFYTLTVCASDGGAPPLEHVAVV
HVQVFPCPCVFQVHGSEAVDGRAEHPLVRRFTVREDAELATVIGSARVPDEGRFRYSISE
GDGSVQFGIDASSGDIYVNQPLDYEAAAQYVLVVRAEGAGLAPGANASVLVSVMVEDAND
HTPWFPDKMVLLGLSEDATVGSLAFAFQARDADGTFPNSAVRYGLTYDPKVTDSSTRFPF
QMNPYTGSLTVTAPLDRETTSSFAFTVTATDQARRKEERKQATVAAQVFLLDVNDNRPVF
ISAVSVQVMEDAEVGSLLHRFVAKDGDEGENGLVSYTILTGNKKGMFTLEGNTGLLFLAS
ALDYESQRLHRLIVEAVDHGLPSLSSTQTFTVEVADVNDQPPVFSQSVYNASVAENKDPG
EPVARVSATDGDSEENAVVWYSLLPGPGYELFSINPDTGLITTASYLDREQQHGFTLRVQ
ARDSGPRPLSATATVLCSVLDDNDNPPAFMQSSFRISLPENLPPGAIHTAQASDPDLGEN
GTILYSIVGEDCAGCFTVNSRSGVVSTTKVLDREEKQNYTLTIQARDYGPTPLSSSTQLQ
LVLLDRNDNAPSFSRKSYQASVSEGLPPGAEVLRVSAFDPDEGPNGRVTYSLTEDSSQGA
FSVDSLTGVIRTTGPLDRESRAQYTLRAVATDGCTQGPLTSVASVTVQVEDVNDNVPICD
QNPVNAWVSARTLPNQIVATVTAEDSDQGENGTIQFALSDEENLFDINRETGEISVRRRV
RAGFSGRKLEVMVSDRGRPVLTSTCLVFIHLKGENEGLQFTNKVYNATIKENSGAGILVT
KVEASGEAGSRQSVVYTIFSGNENSLFSINHHTGEIRVQKDYALDFELSPHIHLVVLADN
GLQTTHCRVSIHLLDVNDNAPRFERSSYRTAVWEGQAHNTYVMQMFASDADSGINGQIEY
SIVSGDPNEAFILDSVRGILATSIPLDREITPSYKLVLQAADQGDPPLSSTATVRVQVVD
VNDNSPAIPHMEPVVIAENRPAGHTVTQVTANDVDLSSTIRYSLSGNSSLGSPFAINQYT
GVVSLTRALDYEEQAEYTLTVLASDSLHQTSGEVKVQVLDLNDNAPVFSEDSYQVDLSEL
ATADTLVLSVSATDRDSGPNGEITYRLLSSPLQGFYIQADSGAIFTNKPIKATANGNLIH
LLVEAKDGGDPALSSVASVDVQILDTNDHVPTFHQEVYSLTIPEDTPTDATLLTLSAEDQ
DWSPANTHLDYAITQGNEERRFCLEVRLVPIENQWRNVGKLVLCNALDRETTDSYVLTVS
VSDRGDPPLNSSAVVMLTVADRNDNAPVFSSTEYHAQVSESSPRGTRLVQVSARDPDLGA
NSLVRFDIISGNSKGHYKLDPESGLLAVNQSLDYEQDPKYILTVRASDGGEFSEKHQVAF
AVVFITVLDENDNSPHFVFSTVNCSVLENLPAFTHTCSVHAVDNDLGSYGQLTYSILSPC
FLDYDSGSPEKKEAFAIDPLTGDVHTRQTFDYERESEYCFVVEARDKGGKTATVRVQVSI
RGVDEFSPIFTQKQYHFLLPGHSKPGDVVGFVMAMDHDRGVDGIVGYSLVSSSPFFSVNK
TTGSVFVSEPVYRRRGSHGEDLVKLLVSAGSPKLSSRTTTCVVFINISSSAEALAGAPLD
AHMLSLGVSLVVILAVLLVFVGLVLRYKMKEAALKKAAAIAANLNPGAGSFSRSSSQNQS
IITLQEIKRPSIVVVKRELSNPYGQSDSSGRGSAEGETAEDQEIKWIIDYPCRRGGDPVL
GEQEAESPHWVPPRADISSQPVGAAPERLPEKRLSSEMASTESLHHFKEEGGGEGLLPPL
PAIADSLSSLARRDEQLQGSYGWDHILDWEPRFQAMASVFTDIGMLPDRELQVGRGDSAA
EASSLMHPPPLITAVAQPGIRSVPPRRPGLVRSLSRRRSSRKYAYSPLARDTGLTPTAMT
PSFSPSLSSLTVRTPNASP
Download sequence
Identical sequences H3CNT4
ENSTNIP00000009917 99883.ENSTNIP00000009917 ENSTNIP00000009917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]