SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009928 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009928
Domain Number 1 Region: 3817-4007
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-38
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 3222-3327
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-31
Family Cadherin 0.0006
Further Details:      
 
Domain Number 3 Region: 3328-3439
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-30
Family Cadherin 0.0007
Further Details:      
 
Domain Number 4 Region: 3120-3222
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-30
Family Cadherin 0.00082
Further Details:      
 
Domain Number 5 Region: 1123-1252
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-29
Family Cadherin 0.00075
Further Details:      
 
Domain Number 6 Region: 1554-1655
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-28
Family Cadherin 0.00056
Further Details:      
 
Domain Number 7 Region: 2275-2380
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-27
Family Cadherin 0.00057
Further Details:      
 
Domain Number 8 Region: 2801-2917
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-27
Family Cadherin 0.00054
Further Details:      
 
Domain Number 9 Region: 3017-3125
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 10 Region: 454-557
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-25
Family Cadherin 0.00064
Further Details:      
 
Domain Number 11 Region: 814-917
Classification Level Classification E-value
Superfamily Cadherin-like 2e-25
Family Cadherin 0.00034
Further Details:      
 
Domain Number 12 Region: 1016-1134
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-25
Family Cadherin 0.00065
Further Details:      
 
Domain Number 13 Region: 1757-1877
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-25
Family Cadherin 0.0007
Further Details:      
 
Domain Number 14 Region: 136-255
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 15 Region: 1442-1549
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 16 Region: 2911-3023
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-22
Family Cadherin 0.0019
Further Details:      
 
Domain Number 17 Region: 2067-2174
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 18 Region: 721-810
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 19 Region: 2582-2692
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-21
Family Cadherin 0.0019
Further Details:      
 
Domain Number 20 Region: 1865-1990
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-21
Family Cadherin 0.0019
Further Details:      
 
Domain Number 21 Region: 913-1029
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-21
Family Cadherin 0.0028
Further Details:      
 
Domain Number 22 Region: 3432-3536
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 23 Region: 2174-2281
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 24 Region: 1660-1763
Classification Level Classification E-value
Superfamily Cadherin-like 7e-19
Family Cadherin 0.001
Further Details:      
 
Domain Number 25 Region: 2381-2481
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 26 Region: 2484-2594
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-18
Family Cadherin 0.0022
Further Details:      
 
Domain Number 27 Region: 1229-1347
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-17
Family Cadherin 0.003
Further Details:      
 
Domain Number 28 Region: 560-661
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000571
Family Cadherin 0.0021
Further Details:      
 
Domain Number 29 Region: 1355-1454
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000514
Family Cadherin 0.0055
Further Details:      
 
Domain Number 30 Region: 2698-2807
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000799
Family Cadherin 0.0041
Further Details:      
 
Domain Number 31 Region: 1974-2079
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000999
Family Cadherin 0.0032
Further Details:      
 
Domain Number 32 Region: 362-461
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000157
Family Cadherin 0.0028
Further Details:      
 
Domain Number 33 Region: 32-148
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000186
Family Cadherin 0.0036
Further Details:      
 
Domain Number 34 Region: 4134-4173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000675
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 35 Region: 4060-4096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family EGF-type module 0.015
Further Details:      
 
Domain Number 36 Region: 4022-4060
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000498
Family EGF-type module 0.013
Further Details:      
 
Domain Number 37 Region: 3541-3637
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000171
Family Cadherin 0.0076
Further Details:      
 
Domain Number 38 Region: 261-353
Classification Level Classification E-value
Superfamily Cadherin-like 0.000003
Family Cadherin 0.0092
Further Details:      
 
Domain Number 39 Region: 4099-4138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009928   Gene: ENSTNIG00000007126   Transcript: ENSTNIT00000010106
Sequence length 4610
Comment pep:known_by_projection chromosome:TETRAODON8:18:8714988:8761774:1 gene:ENSTNIG00000007126 transcript:ENSTNIT00000010106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKHLVMLLMLLLQLLCGCAGNQRMPRAAPMQFTQPVYNATIYENSAAKTYLESHTKMGI
YISDPAWEVRYKIISGDNENLFKAEDYLVGDFSFLRIRTKGGSTAILNREVKDHYMLTVK
ASDRNTNLESRTRVKVQVLDTNDLRPLFSPTSYSVSLPENTAIRASVAKVTATDADIGTN
GEYYYSFREWTDMFAVHPTSGVVTLTGKLDFSETRLYELEILAVDRGMKLYGSSGFSSMA
KLTVRVEQANEHAPISAVALVPSDADPDPTYVIVTVEDGDHGPNGEIASLSIVAGDPLQQ
FKAVRSSPGSKEYRIKAVKDVDWDSQPFGYNLTLQAKDKGSPPQFSAVKLVHVTPALLKA
GPPVFEKAIYRVSLSEFAPLNTPVAMVTAVPKYPQQKYAFKHKSDQNRFTINSNTGLIST
AGPISADPSPQIELDVITADSKAETKVIIDVTDVNNNAPEFQQTSYQATIDENAPAGTSV
VTVTATDRDRGENGYVTYSITNMSPQPFVIDYFTGVITTSEVLDYELMPRIYNLKVRASD
LGSPFRREVEASVTITLNNLNDNKPLFESVDCEVTVPRDHGVGEQIATVSAIDADELQLV
RYRIKAGNDLDLFELNPNSGVLSLKQTLSEGEAAKVSLHSLQMVATDGEYETRPTFMNIT
VIMARKPVQLKCVETGVASMLAEKLLHGSKIHTQTEPDDNLMDLHSVKPYAPQFAEAFPN
VIEVKEDLPVGARIVHLSATDSDSGFNGKLVYVISGGNTGSHFVVDMETGWLQVYSPLDR
ETANSYTLNVTVYDLGIPQKSSSRLLGVKIRNANDNSPQFLQESYSVQISEGTPVGTEII
QVDSSDKDQGKNGIVKYSILGGTDDFAIDEDTGVVSVTKPLDRELHPVYVLKIAARDQAA
DEPQLVSTVPLRITLEDVNDNPPKFVPPNYRVKVREDLPVGTVIMWLEAHDPDVGPSSQV
RYSLMDNGDGHFEVDKLSGARIVQNLNYETKQVFNTARAKDKGKPVSLQSTCFIEVHVVD
VNENLYKPLFRSFVEKGFIKEDALIGTPVMTITAEDEDKGQDGEVRYSIRDGSGLGIFTI
DEETGIIRTQELLDHETTPHYWLTVYAMDRGVVPLSAFVEVYIEVQDVNDNAPQTSEPVY
YPSVMENSPKDVSIIQINAIDPDTKASDRLSYRITSGNPQGFFSINTRTGLITTTSRKLD
REQQDEHILEITVTDHGVPAKSTSVRVIVQVLDENDNRPLFLEKIYKIKLPEREKPEKER
AIKRDPVYRVIASDRDDGPNAEISYSIEEGDENGKFFIEPKTGLVSSKKFSSAGEYDILT
IKAVDNGRPQKSSSCRLHIEWIPKPKLPPDAAPLQFEESPFVFSVMESDPVAHMVGVVAT
EASDVPVWFEITGGNYDSRFDVGKASGTLIVAQPLDSEQKSNYNTVEATDGTRTVSSAEV
LIRVIDTNNHRPQFSEKFYEVNVAEDTPPGTEVLQISASDRDEKNKLTFTLLSSTDPFSL
RKFRLDPGTGTLYTAETLDHETMHHHILTVMVRDQDIPVKRNLVRVIVNVDDTNDNAPWF
VGAPFSGRVFESAAVGSAVLQVTARDKDKGRNAEVVYSLESGNFANTFSIDPKLGTITVA
KELDRDSKAQYELTVKASDNGVPPLSTTAPVRIAVTVSDNAAPRFTEREFSADVSESAHP
GSFVALVTASSQSSVFYQIKAGNINNAFDINPNSGVVVTQRPLDYETTAQYTLVIQGTNM
AGLGTNTTLLVHLKDENDNAPIFIQKEFRGVVSESAPVNSVVLTRENTPLVVRASDADGD
QNAMLIYQIVEPFAHNYFAIDSNTGAIRITTALDYEERNTFHFTVQVHDLGIPRLFAETA
ANVTIEVTDVNDCPPVFSQKTYEATVITPTYKGVKVIQINATDSDSGPNAKLLLSISEGN
IGDKFKMDPTTGIISVQNVTQLRSRYELKVRVSDGRFSSVATVKINVKENKENKLKFTKE
SYKAFVQENSSEKKTLEVIAAVGNQVNEPLFYNILNPDKKFEISRTSGVVSTTGIPFDRE
AQDTFEIVVEVTREGQSEDGAHVLLTVMVEDANDNRPMFVNLPYHALVQMDAEEGHLIRQ
VTAVDRDMGQNAEIQYLLKEHQEFFQISPSGEISLKKKLQKESLNTDFVIVVVAQDNGNP
ALSAEVEVPVTVVNKAMPAFEKAFYTIEIPENIQLHTPVLHVQANNSEGPRIVYTISEGD
PFKQFSIDFNTGVIHVIQPLDFETHPAYKLSVRATDSLTGAHSDVFVDIILEDVNDNAPV
FLSKAYHANVSEASVVGTRILQVDAKDSDTGNNQEVFFQLVEEKGESSDFFTIDRDTGTI
STAQLLDYEEIRQHELRVRAVDRGVPALSSEVIVTIDVTDLNDNAPEFTQQTYNSTISEL
APRGHFITQVQASDADSSDKDNLLFFFTSGNEDLNFSIDKHTGAILISNHRRVHMQPFYN
LSVSVSDGVFRSSAAVLVTVIGANFHSPTFSQTEFVVELVEHSEIYTPVAEAKATDADEG
IYGQIRYQIVNDFAKDKFSVNENGEIFTLESLDRENNMEKVVPISLVARDGGGKVGFCVV
NVILTDINDNAPQFRAADYKSTIASDVPRGTSVVRISASDLDEGSNADIEYSIEADVENV
EENFEIHPTSGLIVTKESLIGLENELYAFFVRAKDTGNPPQHSVVQVNIRIVAPETPIPK
FNEAQYRYTVAEDLPIGTEIDVIQAESAQPLIYSLVKGSTPESNADEVFVVDRDSGALKL
QKSLDHETTKWYQFLLHSQTKHENFDIVASVIVNIQVKDVNDNKPVFESDPYEAVVVENL
PSGTQVIQVRASDQDSGTNGQVIYSLDARQSSEEISELFAVNSETGWVTTLKELDREKMQ
RYTIAVLATDQGDRIQHATGTRVEVTVADVNDNPPRFTAEIYKGTVSEDDPPPSGVIAIL
STTDADSEDINKQVNYFITGGDPLGQFAIEHIQNEWKVFVKKPLDREEKDNYLLNITASD
GIFTAKATVEVKVLDANDNSPQCEKALYSESVPENSPAGRLILQVSASDADIRSNAQIFY
ELQGAGSELFTIDSDTGELKTLQPLDREEQEEHRFKMRAVDGGGRYCEADIHVVVEDVND
NLPQFSADLYTVTVFENTEIGTYVAKLLANDVDVGPNSNIIYSLLDSADGFFSIDEQTGV
ISLERPLDRELQSTYELRALASDQGLPRLSSVCQVVVSVLDINDNPPVFEHREYTATVSE
DVSVGTQLLRVQAASRDTEANGEISYGIISGNEHGLFSVDPRTGDIFVIQPLDYEASHEY
YITVEATDGGSPPLSDMATVNINLTDVNDNRPVFSQDVYTAVVSEDAELGKTVITVNAED
LDGPSHSHVRYSIVDGNQGSPFTIDSARGELKVAHQLDRERTSGYTLTVVASDNGVPPLS
SSSMINIDISDVNDNPPLFSQANYSLIIQENRPKGTSVLQLTVTDRDASHNGPPFTFAIV
DGNEGHAFHISEQGALVAVGALKRKNVEHYLLQAQVSDSGKPQLFSSAFISVRIIEESVY
PPAILPLDIFVTTTADEYSGGVLGKIHATDQDVYDTLTYSLAPSSSSPSEDSTALFSVSA
SDGKVIALRPLDVGHYPLNVTVTDGRFVAAADITVHVRQASLQALQNSIGVRFANIAPEE
FIGDYWRNFQRALRNIAGVRRNEVQLVSLQPSEQGDLDVLMTLERSGSPYQSQEVVFRKL
NSSAGVIEEMTGVRIVRVVQKLCAGLDCPLRFCDETVTLDRSAMSTHSTARLSFVTPRHV
RTATCQCEGGQCPVLNNVCEKSPCPEGMECVEDLRENEYSCVCPEGKKGKCSDGHSLTFS
GSSYVKYHLMENENKELMKLSLRLRTFSSHATVMYAKGTDYSILEIVNGRLQYKFDCGSG
PGLVSVHSAQVNDGEWHTVSLEVDGNYAKLVLDRVHAASGTAPGTLRTLNLDNRIYFGGH
VRQHASVRHGRSLPVTNGLRGCLEAISLNGQELPLNTRAHRAHAVLEDMVEVTPGCALPP
AESCSSNPCSNGGSCTSLPNGGYFCKCPASFVGTHCEVSISPCASNPCLYGGTCVPRADD
FYCQCRGQYSGQRCQLGPYCRDNPCKNSGKCIDSLDGPVCECEPGFQGDRCLSDVDECVK
NPCSNGGQCQNTYGSYRCNCSLGFGGQVCELPTEIRNEMISTSWNISLGEVIGIVVFVSS
IFILVLLFIIIRKKACRSRSKSDDDKQPGGSGVPHSFLQRPYFDSKLNKNIYSDIPPQVP
VRPISYTPSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPDSVHGHRKTVAVCSVAPNLPP
PPPSNSVSDSDSIQKPNWDYDYDAKVVDLDPCLTKKPMEDSACHPYNTRGSMSEVQSLSS
FQSESCDDNGYHWDTSDWMPSVQLPGIQEFPQYEVVETAPLYSDPNAIDTDYYPGGFDIE
SDFPPPPGDFPASEDLPPPTLPEYSERCDTLRPRGRNLDPAAGSPGGSPGMRQRPAMPQL
YSLNKYLPQHQYASDAGEAEGQEVTATSAAATLGTGGYRGAFPLGCSRDFDSTALDNMSM
SLYTSTASCSDMSACCEESEVMISDYESGDEGQFERLVIPGLDSQQHTEV
Download sequence
Identical sequences H3CNU5
ENSTNIP00000009928 ENSTNIP00000009928 99883.ENSTNIP00000009928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]