SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009940 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009940
Domain Number 1 Region: 5-150
Classification Level Classification E-value
Superfamily E set domains 5.74e-55
Family RhoGDI-like 0.000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009940   Gene: ENSTNIG00000007139   Transcript: ENSTNIT00000010119
Sequence length 150
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:9699255:9702801:-1 gene:ENSTNIG00000007139 transcript:ENSTNIT00000010119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDEDRAKEILKGFKLNWMNLRDAESGKVLWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSSEKLEKFRLEQKVFFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
NVLTGNVIIETKFYDDDLHVSTSRVRLFYV
Download sequence
Identical sequences H3CNV7
ENSTNIP00000009940 ENSTNIP00000009940 99883.ENSTNIP00000009940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]