SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009997 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009997
Domain Number 1 Region: 65-142
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.12e-24
Family Intermediate filament protein, coiled coil region 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009997
Domain Number - Region: 16-66
Classification Level Classification E-value
Superfamily Prefoldin 0.00314
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009997   Gene: ENSTNIG00000007195   Transcript: ENSTNIT00000010176
Sequence length 201
Comment pep:known_by_projection chromosome:TETRAODON8:11:763548:765044:1 gene:ENSTNIG00000007195 transcript:ENSTNIT00000010176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALVAEVRSQYQDIADRNRAEAELWYKTKYEEMQTSAGQYGDDLRTTKAEIAELNRMIA
RLQNEIEAVKGQRANLEAQIAEAEERGELAVKDAKLRIRELEEALQRAKQDMARQVREYQ
ELMNVKLALDIEIATYRKLLEGEESRLASGVSNAVIHVQQSSGGSLQSSHGFGSGSSSSS
YGYGPTVTKSTMSTISSKRTF
Download sequence
Identical sequences H3CP14
ENSTNIP00000009997 ENSTNIP00000009997 99883.ENSTNIP00000009997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]