SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010006 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010006
Domain Number 1 Region: 1828-2074
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.9e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 393-525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000392
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 810-943
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000487
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 4 Region: 243-410
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000119
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 582-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 708-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000645
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 7 Region: 938-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000013
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 8 Region: 1066-1183
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 554-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000224
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 519-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000357
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 11 Region: 211-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000625
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 745-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 13 Region: 975-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000343
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 14 Region: 173-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000373
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 15 Region: 131-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000469
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 16 Region: 1194-1235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000518
Family EGF-type module 0.015
Further Details:      
 
Domain Number 17 Region: 96-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 18 Region: 785-822
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 58-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000157
Family EGF-type module 0.013
Further Details:      
 
Domain Number 20 Region: 1348-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.015
Further Details:      
 
Domain Number 21 Region: 1266-1310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000214
Family EGF-type module 0.012
Further Details:      
 
Domain Number 22 Region: 1014-1057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000357
Family EGF-type module 0.021
Further Details:      
 
Domain Number 23 Region: 1487-1519
Classification Level Classification E-value
Superfamily Notch domain 0.000000222
Family Notch domain 0.0037
Further Details:      
 
Domain Number 24 Region: 1407-1438
Classification Level Classification E-value
Superfamily Notch domain 0.000000327
Family Notch domain 0.00046
Further Details:      
 
Domain Number 25 Region: 1447-1480
Classification Level Classification E-value
Superfamily Notch domain 0.00000034
Family Notch domain 0.0054
Further Details:      
 
Domain Number 26 Region: 15-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000664
Family EGF-type module 0.011
Further Details:      
 
Domain Number 27 Region: 1225-1269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000010006
Domain Number - Region: 1303-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000188
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010006   Gene: ENSTNIG00000007203   Transcript: ENSTNIT00000010185
Sequence length 2437
Comment pep:known_by_projection chromosome:TETRAODON8:4:7172912:7185745:1 gene:ENSTNIG00000007203 transcript:ENSTNIT00000010185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCPSDFVGNRCQYPSPCSPSPCRNGGECRAVSHGNTFDFRCVCRLGFTDRLCLTPTNHAC
MSSPCRNGGTCELITLTAYRCRCPPGWSGKTCQIANPCASNPCANGGQCSAFDSTYICTC
PPAFHGQTCKQDVNECAQTPSPCLNGGVCVNEVGSYHCRCPSEYTGQHCETAYMPCSPSP
CQNGGTCIQKGDTTFNCICLPGFTGEHCEHNIDDCPGHSCQNGGVCVDGVNTYNCQCPPH
YTGQYCTENVDECELMPNACQNGGTCHDTHGSYHCVCVNGWMGDDCSENIDDCASAACYH
GATCHDRVASFFCECPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTG
SACNLDIDECSLGANPCEHGGRCINTKGSFQCKCLQGYEGPRCEMDVNECMSNPCHNDAT
CLDQIGGFHCICMPGYEGVFCHINIDECASQPCLNNGKCVDKINSFHCECPKGFSGNLCQ
VDIDECASTPCKNGAKCTDGPNKYTCECAEGYTGQHCEIDINECYSDPCHYGTCKDGLAS
FTCFCRPGYTGRLCETNINECLSQPCKNGGTCQDRENTYVCICPKGTAGFNCEVNLDDCK
SKPCDYGRCIDKINGYECACEPGYTGAMCNININDCAINPCHNGGTCVDGINSFTCLCPE
GYNDATCLSQVDECRSNPCIHGRCQDLINGYKCACDSGWSGPNCDINNNECESNPCMNGG
TCKDMTSGYHCTCRVGFTGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLENIGENC
ETLLAPCSPRPCKNGGVCKEAEDYQSFSCICPEGWQGQTCEIDINECVKNPCHNAAVCHN
TMGGYQCQCQPGYTGLKCEIDTDDCKPNPCSNGGLCLDGVNSFTCTCPPGFRGGRCEQDI
NECESNPCKNGANCTDCVNSYTCTCPLGFSGINCEINTNDCTDSSCFNGGTCVDGINAFT
CLCLPGFTGSYCQYDINECDSKPCLNGGTCLDSYGTYKCTCPLGYTGVNCQNLVRWCDSS
PCKNGGSCWQQGASYTCQCQTGWTGLYCDIPSVSCEVAAKQQGIDVAHLCRNSGQCLDAG
STHYCRCQAGYTGSYCQEQVDECSPNPCQNGATCTDYLGGYSCECVPGYHGINCSKEINE
CQSQPCQNGGTCIDLVNTYKCSCPRGTQGPSEGVHCEINLDDCTPFTDPLTNEPKCFNNG
KCVDRIGGYQCMCLPGYVGERCEGDVNECLSDPCDPRGSYNCIQLTNSYRCECRTGYTGQ
RCDKVFDGCKGRPCRNGGTCAVASNTPHGFICKCPPGFTGSSCEYNSRSCGALNCRNGGT
CVSGHLGPRCLCPATFTGPECQTPTDSLCISNPCYNGGTCQITPDVPFFRCSCPSNFNGL
LCHILDYSFVGGFGRDITPPPEVEVSCEIPQCDEWAGNHICDSLCNNHACGWDGGDCSLN
FDDPWQNCSAALQCWRYFNDGKCDGQCNSPGCLYDGFDCQGQEGQCNPLYDQYCKDHYAD
GHCDQGCNNAECEWDGLDCANNMPEKLADGHLVLVVHIPPEQLKNRSSAFLRELSSVLHT
NVVFRRDAKGEPMVFPYYGNEQDLVKHNVLKRSADGWPDWASMPADVLGQVKESVSAMVR
PRKRRELDPLQVKGSVVYLEIDNRQCYQQSTECFQSATDVAAFLGALASSGNLNVPYIEA
VTSVRPTSPGSELYPMYIVFLGLAALGFICLGVLVSRKRKREHGQLWFPEGFKVSEPSKK
KRREPLGEDSVGLRPMKNSDINLMDDNQIEWDDEDPDCRRLRLEEQAMLDLCDHGDPRKW
TQQHLDAADLRIACIAPTPPQGEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEE
EDPSAEIITDFIYQGANLHNQTDRTGETALHLAARYARSDAAKRLLESSADANVQDNMGR
TPLHSAVAADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVDGMVEELINCHADVN
ATDDSGKSALHWASAVNNVEAAVVLLKNGANKDMQDNKEETPLFLAAREGSYQTAKVLLE
HFANREITDHLDQLPRDIAQERMHHDIVRLLDEYNVVRSPGLHNAPLNTSSLSPPLASPN
DYLSNLKPSMSVKKVRKLTSGGKGGKDGGKDGRNKKKKSVDGKGNLLDTSAVLSPVESLE
SPHGYLSDVASPPMASPFQQSPPISLNHLQGTGDLLGMNAGKDVGCMSFDPNPPRLSHLP
VSSPHSQGAASLGGSRGGQCDWVSRMHPGVSQQGNFTQAPTMTHNIMSALHGVTTATLSQ
IMGYQNLQTSHLGSPAHMIQQAHSQQLQHQNTNSNPAAGPPLNQSCPNIELNGSEMQQSN
SSGHVMTIHTVMPQETQILGTQFLTPPSQHSYSGPMDNTPNHQLQVPDHPFLTPSPGSPD
QWSSSSPHSNMSDWSEGISSPPTSIHSQVNLIPDQFK
Download sequence
Identical sequences H3CP23
ENSTNIP00000010006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]