SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010008 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010008
Domain Number 1 Region: 88-229
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.6e-36
Family PLC-like (P variant) 0.012
Further Details:      
 
Domain Number 2 Region: 1-44
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000274
Family Ras-binding domain, RBD 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010008   Gene: ENSTNIG00000007205   Transcript: ENSTNIT00000010187
Sequence length 356
Comment pep:novel chromosome:TETRAODON8:Un_random:89172722:89174634:1 gene:ENSTNIG00000007205 transcript:ENSTNIT00000010187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCGCDEYLLEKYPLSQYKYIRSCITVGRLPHLMLVSKDSLYSQLPASGFVTPSYSRRTPQ
PSPCPGGGDGSPPRSLWAFNTPLRVRLLSSLQIYVRTGIYHGGEPLCDNVNTQRVPCSNP
RQHTRSHHRAGRGREWNEWLTYDIYLADLPRSARLCLSICSVKGRKGAIGGRQEEHCPLA
WGNVNLFDYKDILVSGKVALSLWPVPHGLEDPLNPIGVAGSNPNKETPCVELEFSWFNQT
VVFPDEQQIEEHANWAISRELGYNYCHGLSTLTGLRQQRFCGGCRAASLPLLQRSSLRAL
RTGEGLPLETQTLLCQHPRVSAQAAPVCQMELQRRGVPGSQHSWSAANDTNPHNPP
Download sequence
Identical sequences H3CP25
ENSTNIP00000010008 99883.ENSTNIP00000010008 ENSTNIP00000010008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]