SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010014 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010014
Domain Number 1 Region: 33-222
Classification Level Classification E-value
Superfamily L domain-like 2.27e-29
Family Ngr ectodomain-like 0.031
Further Details:      
 
Domain Number 2 Region: 677-721
Classification Level Classification E-value
Superfamily RING/U-box 0.000000656
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 572-621
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000435
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010014   Gene: ENSTNIG00000007212   Transcript: ENSTNIT00000010194
Sequence length 727
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:23268000:23280325:-1 gene:ENSTNIG00000007212 transcript:ENSTNIT00000010194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFFKKKKPSEDSKKKLEYQLCLSKEAGADDILDISACELSEVPSSAFSICKVLQKKVL
ILHNNELRSLTPKGCDIGTLATLKVLDLHDNKLTSLPEDIGKLTSLQILNVEKNRLASLP
SSIGELRLLQTLNLKGNCLCELPFSIGSLSSLRTFDVSDNSIVQLPKQLAYIRTLEIFTL
DAAKMTYPPSSVCTEGSESIQRFLCSEVGIEYCPPSQYLLPVLEHDCGKQETDSLDSFED
AWKGSDLFLLQNKFSEYEKRKEEKQQQKIAFERHLEEKQKEHTQLFLMNTSHKESMLNSV
RQEQERLELGVSQQQKAQEAERMLMLEKVRQAEDDIGSRINNMLLDNNRQKKSAAFFQAL
EEDRIRVEHLAAITQEEANSLRRKEVAAAMQRMLSDSSTMSLLQVVNDVRRQNLVSETCR
SIENFDRKFDKVMSLQILDKSKAINQILQEEEMQKAAFQALQLQKDAVHNYIRDQIKLIE
GELMQLTKLEIKRRSLDTENLQEVLVEQRKALSDMLQQLMKQRDQREQELRQVLVELQQK
SDSNQQNYWMIQYQRLLNTKPLTLRMQEAGVENELVNMLCKLSAQHYLPVLAHHKVTTET
LRHMRSSDLKKIGINEIGVQKAASSKNDEAASVPMASPPLAPPLLPSATVSHAPSSPVTP
GTPVTPSAPSPVGGPGSSECVVCMEAAAQIIFLPCGHVCCCQVCSDAVQGCPLCRSNILQ
RVRLYHS
Download sequence
Identical sequences H3CP31
ENSTNIP00000010014 ENSTNIP00000010014 99883.ENSTNIP00000010014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]