SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010016 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010016
Domain Number 1 Region: 23-129
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-23
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 2 Region: 472-553
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000552
Family SH2 domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000010016
Domain Number - Region: 209-317
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010016   Gene: ENSTNIG00000007214   Transcript: ENSTNIT00000010196
Sequence length 559
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:23450484:23463800:1 gene:ENSTNIG00000007214 transcript:ENSTNIT00000010196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPEVCWPVPMRAIGAQNLLTMPGGVSVAGYLHKKGGNQFSLRKWPLRYTILHKGCVYY
FKSSTSPSPQGAFSLNGYNRVMRAAEETTSSNVFPFKIVHFSKKHRTWFFSAASENERRK
WMQYLRREIDHYNDRYECPICLSSCSDSDEDSFYGTIERMMDIKHPVDTDDDYCEEDDEE
DEEDYVKPDSDCSPTSTGHPTGPPPSYPPPPVPAASQHHQNVNPVSIPFTPHSQKPLLPT
PPPPPPPSVKPIKSRWPSTEGQDMTEWRSPPAAKVLSICNNLETSMSLNGPTFSPFNAVG
SQSPDSYHKGVMETHSIRPFPPPLHSTNAEVSSHRLVAPDSLSPGQTPIGYLPPHSSPQG
LPLIKTAPYNKPEIPKPPSSSAKPQLAATKFKQPGVKPHFRAKNEFFPRRSSPDGQSFRS
FCGSVSFEYTRKPKLGQYKGGHDSDDDYENMQLPDSVFIDTTETLVVERLFRQMMDPPED
GLYGIRNSGTKTSKVLVVWDVSIKKARNYRLFEEDGLIYLDNEMTFPDLAALIEHYYSHP
LPQHGSLCLQKPYVNMLST
Download sequence
Identical sequences H3CP33
ENSTNIP00000010016 ENSTNIP00000010016 99883.ENSTNIP00000010016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]