SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010055 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010055
Domain Number 1 Region: 15-264
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.71e-65
Family Ankyrin repeat 0.0000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010055   Gene: ENSTNIG00000007252   Transcript: ENSTNIT00000010235
Sequence length 690
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:25964798:25973969:-1 gene:ENSTNIG00000007252 transcript:ENSTNIT00000010235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQEEEAEVLALSEHLLIASHKGQADNVVQLINKGAKVAVTKYGRSPLHLAAHKGHLEVV
HILLKAGCDLDIQDDGDQTAVHRAAMVGNAAVIRALLREGCALERQDKDGNTALHEASWH
GFSRSVQLLVKAGANVHAKNKVGHTPLHLACQNGHIQSSKVLLLGGSRPDSRDQLGDSCL
HVAARYNHVAVIRILLGAFCSVSHRNLQAGDTPLHVGATLNHKKTVRLLLEAGADTRTRN
NAGQTALDQAREHNNPAVALLLTKAPQIQSVLRGRSVRKRREKLKAEGRTQSLPRDGSLP
CKDSVSTQSSDGAPCRHEERTGPNAGGGKGAERKFNPSFSDPLRRKEMKQTEVSPRRKPG
PRASACPPPIPPHSWKAYQLFTLYRSQDGRIMQAPLRGCRCEPLVRKLENQLQATKEEMK
TEVHAVQDLINRRVGQQELRSRQQVRVLDKMAVERMSAERSQCLRSIEQRTLQERLETER
SQASLVGELKRWCLSQLQNLELRLSGDPSGTELRAPPSATDAEGQGVEEASPATASNRPP
SAQAVRPKALPAARADGRRRSPSLQDWDLESRQRQRGAPSPSERHRGKASCRGRDRQPGS
CRNRQHRKPAEGRKAGLPEEQPSGGHALEVTQHFLEAVSTQLERWYEGKVEEARSEAYQR
TQAERGALLERIAHLEEELRLLRKSRTDLP
Download sequence
Identical sequences H3CP72
ENSTNIP00000010055 ENSTNIP00000010055 99883.ENSTNIP00000010055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]