SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010063 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010063
Domain Number 1 Region: 129-260
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.9e-25
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 
Domain Number 2 Region: 15-138
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.98e-20
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 3 Region: 293-472
Classification Level Classification E-value
Superfamily vWA-like 5.87e-18
Family Integrin A (or I) domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010063   Gene: ENSTNIG00000007260   Transcript: ENSTNIT00000010243
Sequence length 540
Comment pep:known_by_projection chromosome:TETRAODON8:11:9232276:9267609:1 gene:ENSTNIG00000007260 transcript:ENSTNIT00000010243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAGRCTSKSFSINTRCKNLLDKDTFSKSDPLCVLYTQGVETKQWREFGRTEVIDNTLNPD
FVRKYILDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQTFCTLGEIVGSPASRLEKPLG
DETGRPGKKCGNIILSAEELSNCRFVTFNFCANKLDKKDFFGKSDPFMVFYRSNEDGTFT
ICHKTEVVKNTLNPVWQPFTIPVRALCNGDYDRTIKVEVYDWDRDGSHDFIGDYTTSYRE
LARGQSQFNVYEVINTKKKMKKKKYVNSGTVTLLSFSVESEFTFLDYIKGGTQINFTVAI
DFTASNGNPSQSTSLHYMNPQLNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRV
SHEFPLNGNMENPYCNGIEGILEAYHQSLRTVQLYGPTNFAPVVNHVARYAAAVQDGSQY
FVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDIRISSRGKL
AERDIVQFVPFRDYMDRTGNHVLSMARLAKDVLAEIPDQFISYMKSRGIKPNPAPPPYTP
Download sequence
Identical sequences H3CP80
ENSTNIP00000010063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]