SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010083 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010083
Domain Number 1 Region: 1006-1075
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000853
Family SAM (sterile alpha motif) domain 0.024
Further Details:      
 
Domain Number 2 Region: 883-956
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000671
Family SAM (sterile alpha motif) domain 0.025
Further Details:      
 
Domain Number 3 Region: 1086-1162
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000314
Family SAM (sterile alpha motif) domain 0.09
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000010083
Domain Number - Region: 383-491
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0218
Family Nucleotide and nucleoside kinases 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010083   Gene: ENSTNIG00000007279   Transcript: ENSTNIT00000010263
Sequence length 1250
Comment pep:known_by_projection chromosome:TETRAODON8:11:9435187:9464401:-1 gene:ENSTNIG00000007279 transcript:ENSTNIT00000010263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCEVMPTISEGDSACPPRGAGGVPNGSDQEANFEQLMVNMLDERDKLLESLRETQETLI
QSQTKLQGALHERDVLQRQINAALPQNIEQGRLRGFLSSSLRALPEEIATLTKELNICRE
QLLEKEEEISELKAERNNTRLLLEHLECLVARHERSLRMTVVKRQAPPPSGVSSEVEVLK
ALKSLFEHHKALDEKEQVRERLRVALERVTTLEEQLTSSTQEVSEIRELNMVRQRKDGDS
LERVDGSKPTWKVCLDRLPNGSIDAHDDGSRVSELQEILDRTNKELSQSREHSSALGVRI
AELEAELTNARRELSRSEELSIKQQREQRERLSQREDLEERITTLEKRYLAAQRETTHIH
DLNDKLENELATKDSLHRQSEEKVRQLQEMLEMAEQRLAQTMRKAETLPEVEAELAQRVA
ALSKAEERHGNVEERLRQLESQLEEKNQELGQARQREKMNEEHNKRLSDTVDRLLTESNE
RLQLHLKERMAALEDKNCLIQDLENCQKQLEEFHHTRERLIGEIDKLRNEIDHLKRRSGA
FGDGTHPRSHLGSSSDLRFSMVEGQDSHYSTTVIRRAQKGRLSALRDDPNKTQVCAVFEQ
DYPSLRGSVSHLLGSDIEAESDMEDDVSSTLLSPSGQSDAQTLALMLQEQLDAINEEIRM
IQVERESADLRSDEIESRVNSGSMDGLNVTLRPRALPTSATAQSLASSCSPPNSGHSTPK
HHSRNASHHLGIMTLPSDLRKHRRKVASPVEMDKATIKCETSPPSSPLSLRLESNFAQFT
DTCTDSRGVHSIRVEGLLFGVFTDSRKQKKGIKSSIGRLFGKKEKGGRMEQTVGREPLPA
LTDFEMGVGDTMTLGKLGTQAERDRRMKKKHELLEEARKRGLAFAQWDGPTVVSWLELWV
GMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPL
TSRTSSGNVWVTHEEMENLASSTKADNEEGSWAQCSFSLQTLAYGDMNHEWIGNEWLPSL
GLPQYRSYFMECLVDARMLDHLTKKDLRSHLKMVDSFHRASLQYGIMCLKRLNYDRKELE
RRREDSQHDMKDVLVWTNEQVIHWVISIGLREYSSNLLESGVHGALLALDETFDYSSLAL
ILQIPMQNTQARQVLEREFNNLLALGTDRRLEESGDDKSFRRSPSWRKRFRAREGGAGLG
MMAGSMETLPAGFRMPSMSMPPSVNLMSRKQLQPEAPPRLDPSAVRTYSC
Download sequence
Identical sequences H3CPA0
99883.ENSTNIP00000010083 ENSTNIP00000010083 ENSTNIP00000010083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]