SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010089 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010089
Domain Number 1 Region: 4-163,201-326
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.04e-59
Family FCH domain 0.0037
Further Details:      
 
Domain Number 2 Region: 474-659
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 711-774
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010089   Gene: ENSTNIG00000007285   Transcript: ENSTNIT00000010269
Sequence length 1062
Comment pep:known_by_projection chromosome:TETRAODON8:11:9697317:9709649:1 gene:ENSTNIG00000007285 transcript:ENSTNIT00000010269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVRAQLVEQLKCLDQQCELRVQLLQDLQDFFRKKAEIEVDYSRNLEKLAERFLTKTRSTK
DHLLKKEQTILSPVNCWNLLLLQVKRESRDHATLSDLYLNNIIPRFAQISEDSGRLFKKS
KEVGVQLQEDLIKVLNELYTVMKTYHMYNTDSINAESKLKEAEKQEEKQMGRSGRQDDRQ
TPRSPDTLASIKSEEKPVRRSSVKKIEKMKEKRQAKYTENRLKAIKARNEYLLALEATNS
CVFKYYIHDLSDIIDQCCDLGYHASLQRALRTYLSAEQNVETSKHSGLEMLEGATESLEA
NGDKQKLMETYNNVFCPPARFEFQSHMGDTMGVVCAQQPLESELHQRCQQLQSRLSTLKI
ENEEVKKTMEATLCTIQDMVTVEDYDVSECFHHSNSMESVKSTFSESYLSKPSLAKRRAN
QQETEQFYFTKLKEFLEGRNLITKLEAKHDLIEKTMGESQKTDCCLASRRRDSSVRKQDS
AEAIPLMVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDMDS
IAGVLKLYFRGLDQALFPKDVFHDLISCVSMESLQDRAVHVKKVLQALPSKTLIIMRYLF
AFLNHLSQYSEENMMDPYNLAICFGPTLMSVPEGHDQVSCQAHVNELIKTIIIHHDTIFP
GAQDLQGPIYTIPGAGDDFCDSPHCEPPLVEEPAPDTVSVSHNSEDEADPLEAVARFDYC
GRTSRELSFKKGASLLLYQRASDDWWEGRHNGVDGLVPHQYIVVQDKVDGGRGSPKPDLD
SRDLLEERVSTRGSAASPTGAHVADVYLANLNKMRKRPELGGIRRTFRGPDSDGAGPGAG
GGGSGSVRTASLPVGSALVKEAGEKRPVSAHSILNSVTRHSSLKTKVESPQLRKATPAGR
SKSFSNHRPLDHEVFSQDMETAVSSALSEFGKVERQSASKHTHAPDVVLDTLEQLKGVSG
GGGGGGGASEPSSPLHSRLFRDSEGGSLHAHPLQRSASSASDVPSSFRPAKSQPRSPLPS
AKLRPPATRPKPVVFPKSGGGASSPAPPPPPSPQSNDKSCPV
Download sequence
Identical sequences H3CPA6
ENSTNIP00000010089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]