SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010138 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010138
Domain Number 1 Region: 39-507
Classification Level Classification E-value
Superfamily Sema domain 1.07e-128
Family Sema domain 0.000000533
Further Details:      
 
Domain Number 2 Region: 1077-1338
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-73
Family Protein kinases, catalytic subunit 0.00000000622
Further Details:      
 
Domain Number 3 Region: 657-750
Classification Level Classification E-value
Superfamily E set domains 0.00000000000451
Family Other IPT/TIG domains 0.097
Further Details:      
 
Domain Number 4 Region: 510-554
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000212
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 749-847
Classification Level Classification E-value
Superfamily E set domains 0.0000000021
Family E-set domains of sugar-utilizing enzymes 0.087
Further Details:      
 
Domain Number 6 Region: 552-633
Classification Level Classification E-value
Superfamily E set domains 0.0000000187
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010138   Gene: ENSTNIG00000007333   Transcript: ENSTNIT00000010318
Sequence length 1379
Comment pep:known_by_projection chromosome:TETRAODON8:11:10184875:10194230:1 gene:ENSTNIG00000007333 transcript:ENSTNIT00000010318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHWTSQWWTCVWLQTLLAFTWTTSSTLAPSPFNFSVVYTMPFFQARGPIQNIVNNSFYQ
EVYVASQNVIEAVDQSLEKVWELRTGPVGSPECKICDLCSIDKDPNFLEDTNNQVLLLDT
MFMYLYTCGSSQHGVCYFHQLNWTGEPPSLSKCLYRKESNSAAYCPDCVASSLGTKVTMV
EEGQTVYFFVASTVNDSVSQRYGRKSLSVRRPLATEDGFYSDVRGLTVLPSLRNAYHIEY
VYSFFTQEFVFFLSVQRESPDQESSPFQTRLGRLPRNEWEMKRYREVILECRFEPKRRRR
AVGSEPYKDVVYNVVQAAHFGKAGRELAKELGAEEEDDILYGVFAVTDDSGVAEHDSALC
AFPMDIVNTAIADGVDDCCQSGPEQLSRGLCHFQPCESCPHESMENNATCKDQPTMVSKP
YYRVDLFNRQMTDVLLTSLLVTTIENKTVAHIGTSTGRLLQLVLTRSSPIIFANYSLVEN
QRVSSIAAVYSSEYLLFVVGDKMIRVPQRGPGCQHFLTCAMCLMAPQFMGCGWCSGVCSW
ENQCDDRWRNESCPPGIAGFFPRTAPPDGQTELTVFGWEFQSPLRPAITSRTHQVRLGHT
ACTVLPAKSNNTHLVCKIRIRTTELFTPVNITVEVHEGKAEGRYSIDGKAEMSGFTFVIP
NITEIRPNYGPRVGGTLITVTGLHLDAGRTRKVTLNEVPCPIKRVTQPKGNVSSIICLSQ
HISEVRDVPLSVFIDKSPIPTTKVFYYKENPKITAVLPDCSFDRNCRGSKIVIEGENLDS
VYRTIVRFKPNESHLKPVTRECVGNSSPTRMECFTPAFPRDETEEGELSFDMDGDLGLWN
REFSYHPYGEPIPFETEGHVLSLYPGFDEVSLHHQKLNLVSSCMTIVMTVAGVNCDAKVL
DNEITCRIPKNMSIPREGLPVKISINGQVHNVGSVVRVSNHYMVGIVLGILTALVAGAVL
AFLVMKHLRKKKKALMIENRLAQSASRSSANNVEMMPVGDYRRAVATLNPPSPLAGPVVF
PSLAYATGSIDPTLTPLIPPEKISISSFRPELLEEVKDVLIPAEMLVVQHHRIIGKAGHF
GTVYHGYFTDHTNREIHCAVKSLNRITDAEEVEQFLKEGIIMKGFHHCNVLSLLGILLPQ
EGLPLVVLPYMKHGDLRHFIRCEKRNPTVKDLIGFGLQVATGMEYLAQKKFVHRDLAARN
CMLDESYTVKVADFGMARDVLDKEYYSVQNHRKAKLPVKWMAIESLQTQKFTPKSDVWSF
GVLMWEMLTRGASPYPDVDPYDITHYLLRGRRLPQPQFCPDPLYRIMLQCWDPEPELRPS
FATLVSAVSIILSNLEGEHYISLNVTYVNLDQPRPYPALTESADEYDSTDAEDSESAST
Download sequence
Identical sequences H3CPF5
99883.ENSTNIP00000010138 ENSTNIP00000010138 ENSTNIP00000010138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]