SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010140 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010140
Domain Number 1 Region: 5-483
Classification Level Classification E-value
Superfamily Sema domain 1.29e-176
Family Sema domain 0.0000000000343
Further Details:      
 
Domain Number 2 Region: 545-628
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000305
Family I set domains 0.054
Further Details:      
 
Domain Number 3 Region: 479-530
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000488
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010140   Gene: ENSTNIG00000007335   Transcript: ENSTNIT00000010320
Sequence length 721
Comment pep:known_by_projection chromosome:TETRAODON8:11:10234197:10249773:-1 gene:ENSTNIG00000007335 transcript:ENSTNIT00000010320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELRSTGTAHHFAYLLNTSDYRILRMDEDYDRMYIGSKDHILSLDLHDINKEPHIIHWPVS
ERRKMECLVSGKDANEECANFIRLIEPWNRTQLYVCGTGAYNPVCTFVNRGRRPQEDIFH
LEPGRVESGKGKCSYDPKLNSVSALINGELYAGVYVDFMGTDSAIFRTLGTKTAMRTDQY
NSRWLNDPTFVHVHLIPDSAERNDDKLYFFFREKSSEMGQSPVTQSRIGRICLNDDGGHC
CLVNKWSTFLKARLICSVPGADGMETHFDELRDVYIQPTQDTKNPVIYGVFSVSGSVFKG
SAVCVYSMADIRMVFNGPFAHKEGPNYQWVAYTGKIPYPRPGTCPGGTFTPNMKSTKDYP
DEVINFMRNHPAMYNPVYPVHKRPLVVRTNVDYEFTTVAVDQVAAADGNYEVLFLGTDKG
TVQKVIVLPKDDLQTEELVLEEVEVFKVPTPITTMKISSKRQQMYVSSVVGLTQLALHRC
DMYGEACADCCLARDPYCAWDGKSCSRYSASQKRRSRRQDVRYGNPIRQCRGFNSNANKN
TLEMVQYGVEGSSTFLECQARSPHALIKWHLQRDNSDRRKEMRSDGRVLKTEQGLLLRSL
QPSDSGMYQCTATEKNFKHLLVKLQLVVLSSRAVNNVLVEGAGGIVSSSLHSSSTQWTPS
AGQYKDLLTILSQPEMTLINQYCQDYWQFGDPLLGALKAKDLKELKEQKKPRNRRHHREE
V
Download sequence
Identical sequences H3CPF7
ENSTNIP00000010140 99883.ENSTNIP00000010140 ENSTNIP00000010140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]