SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010166 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010166
Domain Number 1 Region: 269-421
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-34
Family Third domain of FERM 0.0017
Further Details:      
 
Domain Number 2 Region: 160-268
Classification Level Classification E-value
Superfamily Second domain of FERM 6.93e-23
Family Second domain of FERM 0.0013
Further Details:      
 
Domain Number 3 Region: 75-158
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.59e-17
Family First domain of FERM 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010166   Gene: ENSTNIG00000007361   Transcript: ENSTNIT00000010347
Sequence length 1031
Comment pep:known_by_projection chromosome:TETRAODON8:11:11090061:11106487:1 gene:ENSTNIG00000007361 transcript:ENSTNIT00000010347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WHYISEGDTVGRAASAMAVRLMRGMEDAVASGSQLVWTLAHQTLRRWYNRGLTPCRRFLE
AWFGIGKCYQMTEGRPFQVNLLDGRKLELLVQPKLVSRDLLDLVASHFILKEKEYFGLCF
IDDTGQNNWLQLDRKVLDHDFLKTSGPLELNFLVRFYIDKFTFLKESTTVELFFLNAKSL
VYKETIEVESGNVFKLAAFALQEAKGDYVSNENTRSDLKKLPILPTRVLKEHPSLNYCED
KVIEHYRKLSGLTRGEAIVQYLTLVESLPTYGVHYYPVKDKQEIPWWLGVSHKGIGQYDL
QDKLNPRKLFQWKQLENLYFREKKFAVEVNDPHRKTVAKRTFGQSSLVIYAWYASHTLIK
TIWAMAISQHQFYLDMKQSKLKMTTARSTGDIAMDLTEICNPQISKLAGSESKNHLIMAS
NGSLISAGSADSEVSEEQKKEKVAELKKKEKDLQDKLAKKLEELKKICLREAELTGELPK
EYPLAPGEKAPQVRRRVGTAFKLDDLFPYDEDPYLRNLESRFALQQKIVEAAIKLSNEGD
LAKTVKKKRKNNCLDAMRKLEEIEKEINAYRIQKGKKPTQRASLIIADDVSPSDLSSLSD
SLTLDDEDEVFSQRQRSRSVQYSPRPHHADTLDIHYSKERTSTSTNQHGDGRYKHDALSS
HDSLLKVASRQPRDARSMPPTPLLTRSAFSSTHLRCEDAAQHFRQRSGSLESQSKLTPEA
EAGVPALVFTPAQRSSSTEVLDDGSSYTSQSSVEYSAPGNHTHRHRPRGRHRKNMYANTG
SMPNLAQADTRCYAYQPRGHPATTAFYVTGYPGYADPDPYSHGLYMYENEMEGHYTVNAS
CNPPPAAYHSRDVHTHYGNDEMDSMTHNPYATLRPPRNRPVPRSSEQGSKTFQKAVVAEH
LRGWYQRNTAHKQAAYNYEYEYDRGPQQCLGYQTMHGYSRSTSYSSVSLAPPSGSWSHMN
GGGGGMLEYDMPLHAPQSYSYIKAPYSHSTHSRSYVDVSQVDPHVHQQITRNPDPQDKIY
WHENSKPGTIV
Download sequence
Identical sequences H3CPI3
99883.ENSTNIP00000010166 ENSTNIP00000010166 ENSTNIP00000010166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]