SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010212 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010212
Domain Number 1 Region: 21-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.74e-40
Family G proteins 0.0000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010212   Gene: ENSTNIG00000007406   Transcript: ENSTNIT00000010393
Sequence length 271
Comment pep:known_by_projection chromosome:TETRAODON8:2:4880568:4881531:-1 gene:ENSTNIG00000007406 transcript:ENSTNIT00000010393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAEPSMIKKMSPSESDFAIPSKNCYRMVILGSTKVGKTAIVSRFLNGRFEEQYTPTIEDF
HRKLYSIKGDVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFQEVQRLKRQ
IFETKSCLKNKIKENIDVPLVICGNKGDREFHREVQQEEIDQLVAGDDTCAYFEISAKRN
ENVDTMFRTLFTLAKLPHEMSPDLHRKVSVQYCDMLQRKSLKNKKMKDIGEAYGVVTPCA
RRPSVHSDLMYIKEKAIGGGQGKDKERCVIS
Download sequence
Identical sequences H3CPM9
ENSTNIP00000010212 99883.ENSTNIP00000010212 ENSTNIP00000010212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]