SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010298 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010298
Domain Number 1 Region: 850-1012
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.14e-37
Family Ankyrin repeat 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010298   Gene: ENSTNIG00000007489   Transcript: ENSTNIT00000010479
Sequence length 1022
Comment pep:known_by_projection chromosome:TETRAODON8:4:6055128:6059565:-1 gene:ENSTNIG00000007489 transcript:ENSTNIT00000010479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTIPETPKQTDLEVPNQAAPQPRPRQRLASFGGVSSPGSASPFTGLGAYNQDSKRCSDAG
TEKHAGLSSSLGSRGSTGCLRLSPESSGRTTPVPNLGPTQLQHVRDQMVVALQKLKELEE
QVKIIPVLQVKISVLQEEKRLLACQLKTQSDSEEFNGGLRDAPQSPPSEKGDRVEVPPRK
PSKENTFVYTDKAEVRSVATEVSEIHLGIYTEREAEIDAQQLIIGALKDRISHLEAELKE
SALQAEMSRLKSELKAAGVRTRADKSSHARPSTAGASSEARPTTASQGVGSPTELCHASA
AVQIDVKTVGICCRPELQDVCAGPDVPMSRWEVRERVEVMEKNVGNDILMITRAVGIETK
SRDAETNTEIPVEDLAPRKEKKYSSVACGDCSVHLAVPEGKSQTVSTSTNTAHALIRDAS
MNTVLHTRNRHSNTSQAMTRTVSVGNLAQDMKRTPESCRGCASALKQIQAQASKVTRDIG
VGFININDSFLVGLKTRNMASGPSHLADPIRMRSVGVGEGRIRDVGLSSSHPADKLQPRW
DPELNHYIGKMHKLLGQEDCVQEKVYYFLVQKCHSPPQCSPDSSDCDINLETLAARDSEV
KRMIQKLEQQTSSVLQGEYVACTCAFALLVLNLTELRKWLPPAWQVQQSEGFHLQCLNKM
WCRAPTRFADKPAKSSLLPSGMKKQKGDQGCSSTRKNMKLLRLNPPYKPYAVEKASSEEE
EKTERRRERSKVDLPRRPKCARDHKRSQSNVSQLSSCFHSESANFLSVTCNILFHFRCKL
SEKMFSACQALKVHLSDSRALSSRELLDCLQTVQQEWFSVSSQKSAVPDTVDTYLSAFRS
VSPSVLQHIANMADGNGNTALHYSVSHSNFGIVQKLLEADVCNMNHQNKAGYTPIMLAAL
AAVESPDDMKVVEQLFRKGDVNAKASQAGQTALMLAVSHGRVGMVRALLELGADVNLQDD
EGSTALMCAGEHGHADMVRLLLAQAHCDATLTDSDGSTALSIALEAGHNDAVLLYAHTNY
SR
Download sequence
Identical sequences H3CPW4
99883.ENSTNIP00000010298 ENSTNIP00000010298 ENSTNIP00000010298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]