SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010322 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010322
Domain Number 1 Region: 30-496
Classification Level Classification E-value
Superfamily Sema domain 1.7e-167
Family Sema domain 0.0000000000161
Further Details:      
 
Domain Number 2 Region: 499-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000406
Family Plexin repeat 0.00085
Further Details:      
 
Domain Number 3 Region: 561-627
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000905
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010322   Gene: ENSTNIG00000007513   Transcript: ENSTNIT00000010503
Sequence length 864
Comment pep:known_by_projection chromosome:TETRAODON8:4:6372679:6378639:-1 gene:ENSTNIG00000007513 transcript:ENSTNIT00000010503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNMGFGVLGVFLGLLLEVSTHGPPAMPRTSWRHQDLDLMEFSEPDVFNYTTLLLSETGDA
LYVGAREAIFELSKKNVTIRNNKVAWNVAQNHMVMCTNKGKSKERDCLNYIRVLQVVDDQ
RLYVCGTNAFQPQCDYLNLADFSLSGQSEDGRGKCSFDPSQSFTTVMVDGELYSGTVYNF
LGSEPIISRYSPSQSLLRTEYSTSWLNEPSFVFADVIREGADRGDGEDDKIYYFFTEVSV
EYEFFSKLLIPRVARVCKGDLGGERTLQKKWTSFLKAKLVCSMPELNFVFNVVHDIYILK
GKNWRDTVIYGIFTSQWSNVGFSAVCAYSITAVEEVFSKGKYMQKATVEQSHTKWIRHNG
ITPSPRPGACINNRMRQQNISSSLHLPDKTLQFVKDHPLLEDPVQPIGNAPRLIAKVSYT
QIVVDRVEALDGRLYDVIFTGTDNGMLHKSVVFDGEVRIVEEIQLLKNPEPVKNLLFSSE
TRSLYAGSDSGVVQAPTAFCGRYRSCLDCILARDPYCAWDRRTATCVNIFDAPKQRHGTL
FQSLNGDADQCISKDKSASARVSVKLGSSAELPCVATSNHAHMFWKSNGSVLTETSSFLL
VREGGLLIYSVGPEDQGQYDCWSVEWAPAVGKNYTRLVASYVLTLDLPPRSSHQPQHPAN
TQHTSIAPASETHGKTDRGPPTWTAGTAMLPPTVQLTSLPQTDPSLTQAPGSTIRFQPKL
HSPSSNAPHPGSLAPKAKYLEHSNSSIALVALAYNCYKQYLPAPCLRLRAALLGSHKSEH
QPEYRACEAGLMEASTTDKERQPHHPKAPGLRDTGYETEPEPENSNGQIHCHNSGEESSS
QEKPFDVDCESQPIQFADADETAL
Download sequence
Identical sequences H3CPY8
99883.ENSTNIP00000010322 ENSTNIP00000010322 ENSTNIP00000010322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]