SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010338 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010338
Domain Number 1 Region: 371-588
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 9.94e-54
Family Regulator of chromosome condensation RCC1 0.014
Further Details:      
 
Domain Number 2 Region: 587-750
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.1e-40
Family Regulator of chromosome condensation RCC1 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010338   Gene: ENSTNIG00000007529   Transcript: ENSTNIT00000010519
Sequence length 1209
Comment pep:known_by_projection chromosome:TETRAODON8:4:6687228:6693025:-1 gene:ENSTNIG00000007529 transcript:ENSTNIT00000010519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPCQTHVLLKWQEHFNSSWAVEDTIETARRHGAAALYDRLLQNKEVVTLAQPIQELVGP
RLPDFECESSASTEKEEYLASLLSSQRWLAHRMLTQTSFTLSLHHRLVVLQRIYYAIHSK
YHDKFCVQLPSQSTDSGKECGQLEATSECCRGGAVSNMKSGTDVLIEMGVRTGLSLLFSL
LQQNWRYAASIYPESVLCNDVLATACSVLASLPPLSLANENKIPSVGLDCLAQVAEFLKK
TSVISGTGVADPTGRRLALELLLGLAMHRGSLKFLLEWVEVALARFMSLFNSHRLLLRKS
AGVGFDVIQQTLLQMRQYSGFSGESINTQVLKKDADGLCQLSQAALCLFEEICNLASYCL
CSSSADTACPGTDGDAVTVYVWGSNSSHQLAEGTLEKILLPKLTQGFSDAQTIEAGQYCT
FSVSTDGSVKACGKGSYGRLGLGDSNNQSMPKKLVLEPHRNIKKVFSSKGSDGHTLAITV
DGEVFSWGDGEYGKLGHGNSATQKYPKIVQGPLFSKIVVSASAGYRHSAAVTNDGELYTW
GEGDFGRLGHSDSQSRNTPTLVKDISGVGQVACGSSHTIAVAQDGRTMWSFGGGDNGKLG
HGDTNRVYRPKVIEALHGFIIRKVCAGSQSSLALTSAGQVFAWGCGSCLGCGSSETTSLR
PRFVEDLSITKIIDISCGDSHCLALSHENEVYAWGNNTMGQCGQGHTSTPITRPKKVLGL
EGVSIQQITAGTSHSLAWTAVPTDRQLVAWHRPFCVDLEESTFTYLCNFLKCYCDGLEDD
TPPTPFLSKRDHHQFILLCMKLLSVHLSLAHAGGTGAMVLGSQGRPLRNLLFRLIDSNMP
GSIQQAVLNTLSIGASLLLPPLRERTELLLSLLPRGPQSLNALSKGQLKRLQLEMVLSSL
QDQSYIASLLGYSNFGEFPALGTALTSTTSAQIPSSSTSEVYDPLRLAEVLLRTLVLSIG
FYTSEHLGSWEKNSDKQLVNDSQGQSDPPSHFHQLLSGLHKHLLAHCYIHPSSEGDSNVS
LLQDHLYLLLPCASETLRRATKLLGESSLDKQIIRELHIVLYNSVAGSMLCQVMYSLLLL
PLSTIQPLLSHLLALLEHINNFNRLLPDTNLLEVEELATEAQKSSSDTTEESNGQREENT
WVWLLDLERSLALAVGRCLGGMLQGPPISFQEKTSEFWLSNILFRNGLEMNFDQLDSSMA
WLPDVVMLG
Download sequence
Identical sequences H3CQ04
ENSTNIP00000001564 99883.ENSTNIP00000010338 ENSTNIP00000010338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]