SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010342 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010342
Domain Number 1 Region: 2169-2446
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-96
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000584
Further Details:      
 
Domain Number 2 Region: 648-756
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-29
Family Second domain of FERM 0.00043
Further Details:      
 
Domain Number 3 Region: 758-864
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-27
Family Third domain of FERM 0.0026
Further Details:      
 
Domain Number 4 Region: 1338-1435
Classification Level Classification E-value
Superfamily PDZ domain-like 8.41e-27
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 5 Region: 1059-1159
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-26
Family PDZ domain 0.0052
Further Details:      
 
Domain Number 6 Region: 1474-1577
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-21
Family PDZ domain 0.021
Further Details:      
 
Domain Number 7 Region: 1765-1851
Classification Level Classification E-value
Superfamily PDZ domain-like 1.13e-18
Family PDZ domain 0.0074
Further Details:      
 
Domain Number 8 Region: 1968-2055
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-18
Family PDZ domain 0.02
Further Details:      
 
Domain Number 9 Region: 556-647
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-17
Family First domain of FERM 0.0074
Further Details:      
 
Domain Number 10 Region: 1862-1948
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000999
Family PDZ domain 0.033
Further Details:      
 
Domain Number 11 Region: 47-161
Classification Level Classification E-value
Superfamily PAZ domain 0.000000011
Family PAZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010342   Gene: ENSTNIG00000007533   Transcript: ENSTNIT00000010523
Sequence length 2451
Comment pep:known_by_projection chromosome:TETRAODON8:4:6757339:6779980:1 gene:ENSTNIG00000007533 transcript:ENSTNIT00000010523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLLEEEVWAVLSQSAESLQELFHKGTQAYPSAMGFIISPWSLLLMP
SGNVSFTDEYVTQQDLRAFTAPEVLEGLSLSSVSDIEKMHMYSLGMTLFWGADYEIPQSQ
PMKLGEHLNSLLLNMCDDVTLSRISLRTVLDICSKHIRNSACDPPFSYIRKLVRLVLGSL
SQLDGLLTDRESLPERSKEIRERLRGKGLPSGRSAAPRVLERYRARTQEQTSLNRGLSRS
MGSLPIQGRLLKADEGATQQYSSSDYHPKSDSPTELYPKPLSLQLQARKTWASSVDLACI
DPEALRFGALEDARRGSTAISAHTIGRHKSPLPASREKDFHYSEFGGLKNRKPYHFSASS
VGSGAYDRIKERQRKLQALQQAVDAPTDPLPTHQRYHSDFSSSSESPSVTSSDPDYGQGK
KLAEVRRYGSQMALPSEQDALSLTSHNTHRVRQFEGAADEGLAGAELLLQKQEEEVQRLQ
AHLASRLSRASLYPTDDPPAPSHMSMLDLRDPLYPHRKPKNFHGPEFVKMASEPCVALSV
PSSIMKKRGKVEEVQRKVGVVLLNGQKLELSCDIKAVCKDVFDMVVAHIGLVEHHLFGLA
SLKDNEFFFVDLDAKLSKIAPEGWKEDPKRKKTDVPFNLFLRIKFFLDDINLIQHSMTKH
QYYLQLRKDILEEKMRCDTTNAMVLASLALQAEFGDYQPELHGKTYFRLEHYLSASVLDK
LNHSAIKEELSKLHSNYYEASDAEAELEFLKVCQRMTEYGVHFHRVLPEKRSQTGIMLGV
YSKGVLIFEVLNGNRTPVLRFPWRETKKISFTKKKICLQNTSDGIKHLFQTDSNKTCQYL
LHLCSDQHKFHLQMKARQNNQELQDLENSPLSSLQYPFDPRSGDMVGRTTSSGSLAPTFS
TQSNPDHLKRISYSEVALNKAPPGSVLVQDDLHFPGFNPASSAIITNPRVMSRSHHNLGQ
MPESPEQRVVLHGPLSPHGPQQHQRAGSDPNALLPRQEKSGAGTNISPVWNLSRSNKESD
ASSIEDSGQAYVVGVSMHSSSGLPSTPASVNDSFKKKLSALPSPERDITTVNLKKDAKYG
LGFQVVGGEDSGRADLGTIISSITPGGPADVNGSLKPGDRLISVNDTNLLGLSHANTVDI
LQNAPEEVTLVVSQPKERLYREAASGYEAIQAKASVDTFDSDQDGEISVDDLSDEHGRIE
SPSPPPHSSDAAASSLSPVHQQSSVPDPKTNAVKTKPNGVQQCLDRILATAATSSTGQPH
KPAAHRSLDPVPPALPPKTRRAKFSEAPKAPEHPDRGDSDMDEENHCNSQGKHVPACRNS
PRCPVLCLQEIIMERFSGNAPGPGDLFDVALSKKDSSLGLSVTGGANTTVRHGGIYVKAV
IPKGAADLDGRIQKGDRVVAVNGKSLEGATHQQAVEILRDTGQTVQLLLEKGHPPAERVH
TINTSHCLSPSDGTDKDQIASKEEVREVKEKPEYSFVTPDNVFEVCLLKNTSGLGFSFSR
EENVPNEPLGSSMVRVKKLFPGQPAAESGRISVGDVIMRVNQTALKGLSQHEVISALRGA
GQEVTLLLCRPERGILPEMDALTMTPVPSPRKEPVTAVQPSLTFTKSTSTQSKKSQALVL
EALERLQPKSPGRQNSYSDSTDGDEEVEEVFAAEHSRRAWERSVYHTPGGTLGLGEYDST
GQLDDTVHSAFYSPKLSMTRSDLSKGSPPSPVGADLESVPASAPSPDPLPPPLPLPLNLT
MSSNGQEMEDFVPVSPVTENHLCYQEVELKVSLVKSDKGSLGFTLTKGNDHGCYIHDIVQ
DPAKGDGRLRAGDRMIMVNTTDVSNMSHTEVVNLVRAAPRVVDLLVGRVLEAPKPPIEAH
LLPDIWFNGNQEPLGLVLSGGSDSIYGVLFVKDILPGSAAFDEGSLRPLDLIHYINGAPT
QDLTLSDSNRLLDLTFDNLSLKATRDGQPVFPAQKSDSLVNNNNNTSPNVSSSVNGIPPI
LLLSFVYSFIYCKEEIVTVDLEKPHSGGLGFSVIGGERGIFVKSITPGGIADTSDKLQIG
DRLLKVNDEVMTDLSEDSGAKNYDEGPVEEAREAELSEDTDCDGSSLPEDSPESSRKAEW
PEESVDDPRNENYLQMSAGQPEEDEITWGSDELPMETLDSKLRDDGPIITEEELTCLPLI
KVVPDGQYTGAKLNSVVRMMRGLLEQKVPLQEFDNLQNLEPLDDCLIAQTKENKKKNRYK
NVVPFDTTRVLLGKDGGYINANFIKMSVKDENYMYIACQGPLPTTLSDFWQMVLEQKSNV
IAMMTREVEGGKVKCQRYWPDTPMMPEMVDDRLQITLIKDQFLENFGIRLIEVKDIQTNE
TQLVTHLNYTGWPDHGTPTQPEHLLTFISYMRHIHRSGPVITHCSAGIGRSGTLICIDTV
LGLISKDADFDISDVVRNMRLQRHGMVQTEDQYIFCYQVILYVLRCLQAEE
Download sequence
Identical sequences H3CQ08
99883.ENSTNIP00000010342 ENSTNIP00000002258 ENSTNIP00000010342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]