SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010345 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010345
Domain Number 1 Region: 884-1023
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-40
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 2 Region: 432-573
Classification Level Classification E-value
Superfamily C-type lectin-like 1.55e-39
Family C-type lectin domain 0.00013
Further Details:      
 
Domain Number 3 Region: 143-277
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-38
Family C-type lectin domain 0.00019
Further Details:      
 
Domain Number 4 Region: 5-125
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-38
Family C-type lectin domain 0.00051
Further Details:      
 
Domain Number 5 Region: 723-870
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-38
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 6 Region: 589-726
Classification Level Classification E-value
Superfamily C-type lectin-like 6.24e-37
Family C-type lectin domain 0.00027
Further Details:      
 
Domain Number 7 Region: 1018-1150
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-33
Family C-type lectin domain 0.00058
Further Details:      
 
Domain Number 8 Region: 282-420
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-33
Family C-type lectin domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010345   Gene: ENSTNIG00000007536   Transcript: ENSTNIT00000010526
Sequence length 1151
Comment pep:novel chromosome:TETRAODON8:4:6796542:6803991:1 gene:ENSTNIG00000007536 transcript:ENSTNIT00000010526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTSDPYNDYCYLFNYLSMRTWAEARADCTNQGGDLVSITDPFEQAFIQGVIQHSPTGISL
WMGGHDSVTEGGWEWMDGSPFRYIRWAAGNPDDFYGEDCLSIYINGGYWNDDNCEYKRGY
ICKRRERACRWFTRGTWSPPELRCSGPDWYEFGDFCYKPFRDKKTWFYARETCRSLGADL
VSIMSMTEQSWLESYLYMATSDVWTGMNDLTVSGFFTWSNEHMVTFTYWAPGTPKNHNGF
SEDCVEMLHQTGHWNDVSCSELNTFICKMPKAHYPLPSVKPTVYGCPQGWDAYEYSCYWT
EETARTWSDAKQFCKEQDGALVHIGDLYEQAHFTVVLSGKTGFWWIGLRAHGGQTGGVDY
IWDNGQPLTYTHWDKEQPDTGDGSCVAMAADKIGGFWDDKQCSEKFYFFCEKSRPDITPP
TKAPTLPPSVGCADGWTAMPHFRNCYKFFHNVDWSQRKSWGAANEDCMTRGANLVSIHNQ
EEEDFLSMYSKGSSKWIGLRNNPTDGGYTWSDGTPLSHTNWAPGEPNNHDGREDCVEMVT
SANGSFSFWNDLNCDAHQDWICMIAKGKNPVLPPEPPSPVPAPECGSNPGWRKSNNVCYY
YNDTDDVNFHEALGRCRDEKALLASIHDSDEQAYINSMVGTGKVASAWVGLIMAGIANGQ
YKWVDGSPVSYTHWGSGEPNNANGEEQCVQMNRHQGVWNDANCGRTAGYVCKKLPGDDHT
HPPPTQPWEGNCPEGWMRFKNKCFLFKGKEGDIKANWSYARSWCRGQGGDLAVIDDPYEN
NFVSSYLRDLMLPTWIGLSDLLAENQYAWSDGVSPVLYTNWNEKEPNNAGGTVRMLQEHC
VAMAHNHLVTGKWNDDACHKAHSFVCSRMKSSSIAPPPPTKSPCPDGYVSWYHNCYKLVE
QPATWEAAQAACVQEGGNLASVDMSYDQAFLAGVVLNGKDTWIGLRREVENGSYTWTDGW
PVFFTQWGPGEPSNINGEGCVAMHGGAAFHGTWNDTKCDLTKPYICKISSESPPPTPAPG
NGMCFPLWVPYGRYCYLVVNTQQGFSWPDSRHYCLSIRGELASFHSRAEVEFVRNLNHTK
YHNLWIGLTRDSNLGWAWTDETSLGFLNWAPGEPNSAFHPGSAVEENCVEMYLDGLWNDN
SCLQRRGFVCR
Download sequence
Identical sequences H3CQ11
99883.ENSTNIP00000010345 ENSTNIP00000010345 ENSTNIP00000010345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]