SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010360 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010360
Domain Number 1 Region: 18-137,330-653
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.01e-70
Family Integrin alpha N-terminal domain 0.0000447
Further Details:      
 
Domain Number 2 Region: 156-351
Classification Level Classification E-value
Superfamily vWA-like 1.43e-39
Family Integrin A (or I) domain 0.00000116
Further Details:      
 
Domain Number 3 Region: 656-797
Classification Level Classification E-value
Superfamily Integrin domains 2.62e-23
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 4 Region: 800-925
Classification Level Classification E-value
Superfamily Integrin domains 5.02e-19
Family Integrin domains 0.0098
Further Details:      
 
Domain Number 5 Region: 962-1125
Classification Level Classification E-value
Superfamily Integrin domains 2.51e-18
Family Integrin domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010360   Gene: ENSTNIG00000007551   Transcript: ENSTNIT00000010541
Sequence length 1159
Comment pep:known_by_projection chromosome:TETRAODON8:4:6948761:6961673:1 gene:ENSTNIG00000007551 transcript:ENSTNIT00000010541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSPSSPPTALLACVLSFNVDQKNSKSFSGGSLEDLFGYTVQQFENSEGKWVLIGSPLLG
QPAKRTGDVYKCPVDKEHNTCVKLELPKNTTVPNLHEVKENMAMGTTLVTNPSGGFLACG
PQYGYMCGQQQYISGVCANVSSSFQVLNSIASVQECAKELDIVILLDGSNSIYPWPSITD
FLERFIKTIDIGPKLSQVGIVSYGETVTHNVNLSQFDNTAALMDFVRQLPQQTGFKTMTF
MGINTTRLEAFLPERGARQGVKKVMVIVTDGESHDFHALDEVIAACDRDGIERFGIAVLG
DYNRQNKSKDEIQKFIKEIQSISSEPLKDHFFNSDEVALLTIVDTLGSRIFALEATSSKY
TSSFEMEMSQTGFSAHTSKEGVLLGAVGAYDWNGTVVMHTSGGTIVPGKTQFYDPSVEAG
YERLAGYLGYDVQSASTPDGVLYITGAPRYNHTGRVVVYHLNKTEVVVSQILKGEQIGSY
FGSVLQTLDVDGDSFTDLLLVGAPMFMGPDKDEQGQVYVYRLKQNGQFEHQFTLKPVNQS
CCTAHSRSCRIKNEPCGARFGTAIAAVSDLNLDNFTDVAIGAPLENDHRGAVYIYHGDKM
TLKEKFVQRIAAGGDGSKMKFFGQSIHGVMDLNGDGITDVTIGGLGGVSQFWSRDVAELH
ANLTFDPTKINLQQAQCEHGGRRSTCVTANVCFSYSVKSKQWDPASSTEIRYDLTLDAVR
TKARASFIEGDRKISRTFYIRQSRCRNETFVMEARPDFRDPLLVTLDFGLTEEDRGPILD
ESLPRSINRTILLVDCGSEEKCIADLSLAAKASETWMLIKSSNDKIDVDITVRNRKDNAY
NTKVTLSFTPNINFINVETDIVCSLLEAKVECAVGYPFFGSMEEKSFKVKFEANPKYVEE
FILINVTATSDSEELPSTLHDNSVQISIPVKYEAGINFAVWPVDKHVVVRVGEEYPSTIN
NTTIGEEITMTYTLEMTGATPTPAIDLNVTYPHLSPRGNNLLYLTHMGASPQVTCNTKPK
EINWDVTVLSPLKETLSDFLLSCQNLQCASFSCSIPENTSSQVNVSFRLWKPTFIKGDFS
SLFMRVNASLSVRNSQLFQLSSSQRTQFTIQVSKETLGGIPIWIIIISILIGILILALVI
FILWKMGFFKRKSRDYSKE
Download sequence
Identical sequences H3CQ26
ENSTNIP00000010360 ENSTNIP00000010360 99883.ENSTNIP00000010360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]