SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010378 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010378
Domain Number 1 Region: 625-919
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.7e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000664
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-41
Family Third domain of FERM 0.0000896
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-35
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 4 Region: 27-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-21
Family First domain of FERM 0.0015
Further Details:      
 
Domain Number 5 Region: 517-609
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-20
Family PDZ domain 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010378   Gene: ENSTNIG00000007568   Transcript: ENSTNIT00000010559
Sequence length 931
Comment pep:known_by_projection chromosome:TETRAODON8:2:18011278:18031864:-1 gene:ENSTNIG00000007568 transcript:ENSTNIT00000010559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARFRLPAGRSYNVRATELERDRQHTQVVCNVLLLDNTVQAFKVSKADHGQVLLDAVFK
HLELTERDYFGLHLTDDSLDTPRWLDPNKPIRKQLKRGSPHNLSFRVKFFVTEPSKLQEE
YTRYLYFLQIKQDILTGRLLCPHNTAALLASYAVQSELGDYSETEHTAGYLSEYCFIPNP
PQDFHKEVSKHHQQHSGLSPAQAEFNYLNTARTLELYGVELHYARDQRNTEILLGVMSAG
IVVYKNRVRINYFPWLKIVKISFKCKQFFIQLRREANESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLERPIPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKGIKDRVFARSPS
KPLARKLLGETDWESVSRNSLSDERLETQSLPTRSPPGTPNHRNSLFVQEGTRLRPSSVG
HLVDHVIHASPSLPVFSSSHKSASSTQANSISLDSTPSPEGLDSQPPALPPKQLSRKTLS
QIIQAHSQQSLLDNHVNEMYDVPVNADKTTLNGVVPHDNLVLIKMRPDEHGRFGFNVKGG
ADQKMPIIVSRVAPGTSADLCVPRLNEGDQVVQINGRDISDHTHDQVVMFIKASCESHSG
ELILLVRPNAIYDVVEEKADSEPEFQYIPEKCPQDPTQLDQHALRDSMVTLKEGLSSGAI
LAQFDQLYRKRPGMTMLCAKLPQNVSKNRYRDISPYDATRVILKSTDDYINANYINMEIP
ASSLINRYIACQGPLPNTCSDFWQMTWEQGSSMVVMLTTQVERGRIKCHQYWPNPDSATN
YGDFTVTCHNEEGNSAFLVREMTLMNAQTEQQRELTQIQYLAWPDHGVPDDSTDFLDFVA
LVRSKRAGQDQPMVVHCSAGIGRTGVLITMETALCLMECGQPVYPLEIVRTMRDQRAMMI
QTPSQYRFVCEAILKVYEEGLVKPLKTAIYQ
Download sequence
Identical sequences H3CQ44
99883.ENSTNIP00000010378 ENSTNIP00000010378 ENSTNIP00000010378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]