SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010384 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010384
Domain Number 1 Region: 29-311
Classification Level Classification E-value
Superfamily L domain-like 8.5e-52
Family Internalin LRR domain 0.026
Further Details:      
 
Domain Number 2 Region: 423-459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000246
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 487-555
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000509
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010384   Gene: ENSTNIG00000007573   Transcript: ENSTNIT00000010565
Sequence length 711
Comment pep:known_by_projection chromosome:TETRAODON8:18:10079265:10081400:1 gene:ENSTNIG00000007573 transcript:ENSTNIT00000010565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDPTAVMFQLLFLVLLSSQLLLASECPADCSCNGPGFIFCISRRASTVPRVPADTRNLYI
FQNGIDTLSQDDFEGLGELELLDLSQNKLTEIPDDVFGMLSKMKNLDLSSNVITHIRKDS
FSGLVQLERLYLHGNLIQSIHAEAFEGLEMLLELKLQGNQLSSLPSLRFPRLLLLDLSNN
NIPSLGPSDFQTPHLEALKIVSLGLMSLGDELIASMRNLHELDISMNQLTEVPLALKQDS
LKGLIKLSLAGNPLGDLRVEDFEKLTSLQELDLSGLNLQGFSPSFLEMFPRLTQLTAAEN
PFNCLCPLAWFPVWLKEKKVNLRRPEETRCHFPLVNAGKKLSALETRDFGCPLTTTLPIG
SPTGSTPSIPVSTTPPKMTYTNAIPPPPPPPSEEILPSKTPYPLPPEPTFSPSSTSGEVE
SHICPANICLNGGTCHFDPMGQLSCICLSGTSGLYCENVDIVPDPPKHPVTEATLAASSV
PVQNDAISSRQVTSTSILLDLQRFIETRPHIRGIRLIYRNLSGPDRRPMILSVPASYPEY
TLRGLKPNCTYSVCASPLGERVSLRANSSVDTGSCTEARTEGILMTSSSATAPTPGPMTF
TLILAVSALALVLGVSLVAGTVICVRKRREAKAGMELEMAPADSDPMELDGMKLGLENGA
NGTLPHKQAQINRCHTPLSLQQNGGLDYEVPLMQGHSPSNNNLASLKPSYF
Download sequence
Identical sequences H3CQ50
ENSTNIP00000010384 ENSTNIP00000010384 99883.ENSTNIP00000010384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]