SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010401 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010401
Domain Number 1 Region: 903-1029,1225-1353
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.02e-41
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 2 Region: 505-587
Classification Level Classification E-value
Superfamily E set domains 4.76e-17
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 587-691
Classification Level Classification E-value
Superfamily E set domains 3.06e-16
Family Other IPT/TIG domains 0.038
Further Details:      
 
Domain Number 4 Region: 402-499
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000071
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 5 Region: 52-103
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000249
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 8-55
Classification Level Classification E-value
Superfamily Sema domain 0.0000000222
Family Sema domain 0.018
Further Details:      
 
Domain Number 7 Region: 707-765
Classification Level Classification E-value
Superfamily E set domains 0.0000392
Family E-set domains of sugar-utilizing enzymes 0.066
Further Details:      
 
Domain Number 8 Region: 354-389
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000994
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010401   Gene: ENSTNIG00000001670   Transcript: ENSTNIT00000010582
Sequence length 1354
Comment pep:known_by_projection chromosome:TETRAODON8:19:3269341:3321982:1 gene:ENSTNIG00000001670 transcript:ENSTNIT00000010582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRVDGSSLALQYETVQAVDNGPILRDMAFSSDYHYLYVMSETQLSRVPVEACGQYSSCSE
CLGSGDPHCGWCVLHNTCTRKEKCERSLEPRRFASDIRQCVRLSVHPNTHFSVPEQYKNR
LVLEAHNVPELSAGVNCTFEDLAEMNGLVEGNRIRCSSPAEKEMPRIIVDKEDHQIVQLY
LKSKETGLVFANTTFVFYNCSVHKSCLSCVSSPYQCHNFCSYETRHLCCWQGCHCAVVTG
LLTLHQGCPQLLPADRILVPVNVVKPITLRAKNLPQPQSGQRGYECLLTIQGNEHRVPAL
RFNSSSVQCQNTSYFYDGMEMSSLPVELTVIWNGDFTIDNPTHNKVHLYKCDAQRGSCGL
CLKADPLFGCVWCKGENRCTLKQHCPHPENQWLEHNGINSKCTHPRITKITPLRGPREGG
TLVTIRGENLGLDFREIQGNVKVAEVDCTPIREGYIPAEQIVCEMGKAEKSQYTGNVQVC
VGVGECRPEFMAKSSKYYYFVIPRIINLKPSRGPVSGGTIVNITGSHLDAGSNVSVMFKD
QPCTYLRRGGQWLTCRTHASLHGYGNVSVSVSIDKAHLQKDLRFEYVEDPTITKIEPEWS
IYSGHTAVTVTGTNLDIIQTPLIRAKYNNHETLNLCQVLSPTSMLCQAPELPISLARQQE
VLEKPDEFGFKLDDVQSLMALNNTNFIYYPNPEFELLSVTGVLELKPGSPIILKGRNFLP
PTSSGNGRLNYTVLIGEKPCMLTVSETQLLCESPNLTGRHKVLVSAPGLNFPPGVVHITS
DSPLSSTAIISIAAAGAMLILVIVVVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECK
EAFAELQTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIEEHPVLRDLEVPGYRQEQVEK
GLKLFGQLINNKVYLLCFIRTLEAQRGFSMRDRGNVASLIMTVLQSKLEYATDVLKHLLS
DLIDRNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQME
KGPIDSITGEARYSLSEDKLIRQQIDYKTLVVNCIHPENEKSPEIQVKVLNCDTISQVKE
KILDAIYKNIPHSHRLKASDMDLEWRQGRGQRMILQDEDITTKIEADWKRLNMLSHYQVP
DNAVMALVPKQVTAYNSVNNSTVSRTSASKYENMIKYSGSPDSLRSRTPMITPDLESGVK
VWHLVKNHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALP
LAIKYMFDFLDEQADKHNIHDPHVRHTWKSNCLPLRFWVNVIKNRSITDACLSVVAQTFM
DSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVER
Download sequence
Identical sequences H3CQ67
99883.ENSTNIP00000010401 ENSTNIP00000010401 ENSTNIP00000000963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]