SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010405 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010405
Domain Number 1 Region: 988-1183
Classification Level Classification E-value
Superfamily vWA-like 4.9e-53
Family Integrin A (or I) domain 0.00036
Further Details:      
 
Domain Number 2 Region: 2-187
Classification Level Classification E-value
Superfamily vWA-like 2.37e-45
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 3 Region: 655-818
Classification Level Classification E-value
Superfamily Fibronectin type III 4.65e-17
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 4 Region: 210-256,353-470
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000468
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 5 Region: 480-563
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000279
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 6 Region: 567-649
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000664
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 7 Region: 833-923
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000373
Family Fibronectin type III 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010405   Gene: ENSTNIG00000007591   Transcript: ENSTNIT00000010586
Sequence length 2153
Comment pep:novel chromosome:TETRAODON8:19:2990246:3013217:-1 gene:ENSTNIG00000007591 transcript:ENSTNIT00000010586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRTVVQADIVFLVDESWSVGQNSFSHVKDFISAIITSFKDSVVGTEGVRFGVTVFGDVPK
MRIALTDYSSQEEVLRAIRDLPYEGRSRRIGDALTFLVQHVFSPVIRRDHGPKIAVLITN
GRSDDPVDAAARLVADSGISLFAVGVGGADASELRRMVSEPREEHLLLGADYSALENLLA
RLSRRVCVTASEPPRPVKMSPTVKVPVVGPRDLQVSELAHSSLRLTWSHATSDVRGYGLV
VTPLTSQGHPLHLQQRQIVPANESFVFSCASLPSKENQARHLASVPLNIRLNCGENRALR
CSNKQNNVQNPPFCRRCRLQFLYGISASCVCRSTWKCQHGALEQMELKAEVSTTVVTDLS
PRTEYSLSVYAVYPGLIGDSATITVQTTPLPQVSNFRVIEEGLFSLRLGWTPPPGFMKYF
CAAADRPGFIYEQLLPGDTSSHVIGNLEEDKEYTVSISADYPQGPNQPVSLVAKTLKLVP
VSKLLVQNATTDTVQARWASVRGASGYRLTWQSPDGHIENINLGDTFSFYMIQGLSSGTE
YTVTINPIFGDTEGSITAAKIKTLESSAVQTLKVSSVSTSAALVSWNSVPGATGYRLAWG
PTSGGSTTLKPFTTEFRIKNATHDTEYVLTLYVLFGSVVGPGVSATFKTSPLGFVSNFKV
TSYTSSSIAVEWSPVVGAAQYKLSWKTGDGKPQSVYLDSSVFSHRIGNLTPKSAYDITIH
AVYSNSEGPESSLSQLTDFGPVPRVKEVKVVDVGINSISFTWKHTPGASGYKVSWIPFPG
GDQKFSVLSAASNSFTISKLRESSAYRVQISAIVGQREGNPVLVPARTLDLPRVQDFAAL
SSTESSVVLSWTRVADASGYLLTWRHISVLETKSQKLGPSFSSLKVADLLHERTYIFTIR
PLYEDVEGPISTVYRKIEGQDSPVVTVLSVPATVTPHVAPTVASTTEHTSTAPATKSRPT
EKPESQLRVTQARGGETSGRSTTSGVTATTAAQRAVCGRNKADIVFLVDESSSIGPNNFI
RIKDFIFRVAAYFPAVGPQTTQFAVVHYSDDPRIEFRLNDFKDRNAMLRALRGLRYVGGN
TRTGKGISFVVEEVFQESLGMRPDAAHVLVLITDGKAQDNVVPPSRIARALGVSILAVGV
SNADIEELKRMAAPTSYTNIFYSPTFDDFPSIERDFVSSLCSEELLSEFKEHDEPQGPCP
SQCVKGQKGERGDGLGLGSLVFTHIHPPLKFRQNAGQYDPFESFKGQPGERGPPGTDGVP
GLPGRPGRTGPPGPGGQRGLPGTPGDVGPSGLPGAKGQRGERGEPGYVIASPGANFVPGR
KGEQGPPGPQGLPGVPGADGPPGLPGLSGPPGLPGLSVKGDSGDPGEKGLRGKPGVKGDK
GEMGRDGIAGLPGPIGIDGVPGLPGPKGEKGENAIGIRGVPGLPGEPGEKGNIGLMGPVG
PKGDHGEQGIPGIVGPRGKKGLTGEQGDKGERGVMGPPGPPGPPGPTGLTGPLGLKGDIG
PRGPPGDPAKGILGQAGKKGARGDVGPVGATGPKGFKGEQGDNPGYGIPGQLGPKGENGE
RGNVGLSGKPGTNGQDGAKGDKGSPGLPGNPGEPGLRGKDGADGIKGDQGIKGEQGLPGQ
PGERGTRGLLGLPGNPGEKGNPGEPGPQGADGKKGDKGEPDQPFPVPHHVTHLQPATVAH
AALGTKGQPGPPGPQGERGEPGEKGEAGLPGPRGPEGKPGQPGPSVVCVYIKPCGGLVRN
GLDGLPGKPGMKGEQGQKGEPGQKGDKGEHGRLGIAGMPGLPGIPGRPGIDGKRGQPGQD
GERGQKGENGKKGETGEAGPNGSKGEPGPPGLPGRQVLVTPEVLQAFPIPMGPPGATGSP
GFKGNKGEMGLKGDKGTRGFRGIKGERVSPVKRRECCLRQLHDSLSEGSALQIQGPRGYK
GSKGDLGERGPPGFDGDKGEKGEDGPPGVKGIKGDAGIKGALGRFGARGPVGQKGELGEP
GINGVRGNNGQNGMDGIKGDKGDVGLQGLRGIQGDKGQPGLPGDQGGKGFRGLPGRTGSP
GSTGEKGNMGLSGNPGTPGLNGPMGQKGDKGDGGINGVVGIQGVKGERGPAGFPGFPGFK
GSAGIPGRNGHRGPSGPPGHRGDPGPKPGTPGLKGKTGTSGTEGAKGEKGEPG
Download sequence
Identical sequences H3CQ71
ENSTNIP00000010405 ENSTNIP00000010405 99883.ENSTNIP00000010405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]