SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010457 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010457
Domain Number 1 Region: 162-357
Classification Level Classification E-value
Superfamily E set domains 2.01e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000367
Further Details:      
 
Domain Number 2 Region: 53-178
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.45e-23
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010457   Gene: ENSTNIG00000007642   Transcript: ENSTNIT00000010638
Sequence length 416
Comment pep:novel chromosome:TETRAODON8:7:10835393:10837629:-1 gene:ENSTNIG00000007642 transcript:ENSTNIT00000010638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQDVESSAIVRQPKLPKQAREDPPKQLAEMDRAKKIQRYVQKDGKCNVHHGNVRETYRY
LTDIFTTLVDLKWRFNLFIFVLVYTVTWLFFGFMWWLIAYLRGDLDHIEEDAWTPCVNNL
NGFVSAFLFSIETETTIGYGYRVITDKCPEGILLLLIQSVLGSIVNAFMVGCMFVKISQP
KKRAETLVFSTNAVISMRDGRLCLMFRVGDLRNSHIVEASIRAKLIKSKQTKEGEFIPLN
QTDINVGYSTGDDRLFLVSPLIICHEINEKSPFWDISQAHLAKEELEIVVILEGMVEATG
MTCQARSSYVSSEIKWGYRFTPVLTLEDGFYEVDYNSFHDVYETNTPPYSAKELADIASR
SRLPLTWSMGSKLSQQGLAESEQEAQETKTEPEAQTKSQQPERNGDIANAESESKV
Download sequence
Identical sequences Q4SPX1
99883.ENSTNIP00000010457 ENSTNIP00000010457 ENSTNIP00000010457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]