SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010480 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010480
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily PX domain 3.14e-36
Family PX domain 0.00000311
Further Details:      
 
Domain Number 2 Region: 148-221
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-20
Family SH3-domain 0.0000854
Further Details:      
 
Domain Number 3 Region: 225-336
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-19
Family SH3-domain 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010480   Gene: ENSTNIG00000007665   Transcript: ENSTNIT00000010661
Sequence length 424
Comment pep:known_by_projection chromosome:TETRAODON8:7:10666124:10669384:1 gene:ENSTNIG00000007665 transcript:ENSTNIT00000010661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTYVRHVQLLGFEKRFFPSQHYVYMLLVKWSDLTEKLIYRTYPEIYTFHKALKEMFPI
EAGKIEKRDRIIPSLSAPPWLDSQKSTETRQTSLSDYCQALVNLPPHISRCTHLTSLFKV
RPEDENPAAPNTLKRNETFVVSRDLARGNASEISGPIILDMYRAIADYTKTTKYEINLLA
GDQVEIVEKNQNGWWFCQMDSKRGWVPASYLEPLDGPEESEEADPDYEGELFITIKAYKA
EQEDEISLDLGESIEVIHKLLDGWWVVSRKGEGTGYFPSMFLQKASKRAQAEAARNHLQG
QKPPPRRSTIRNAKSIHNKSRQRLSQDAYRRNSRRYLQQKGGQRDLQNKYARTAAKSPLQ
ERKNQGNIPEESGTASEGEPKKEAPVVPPRPSPELILQRCSDNTRKKISIQASSSASTSK
LGQA
Download sequence
Identical sequences H3CQE6
ENSTNIP00000010480 ENSTNIP00000010480 99883.ENSTNIP00000010480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]