SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010537 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010537
Domain Number 1 Region: 176-297
Classification Level Classification E-value
Superfamily PH domain-like 2.5e-29
Family Pleckstrin-homology domain (PH domain) 0.0000123
Further Details:      
 
Domain Number 2 Region: 19-78
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.7e-21
Family Adapter protein APS, dimerisation domain 0.00017
Further Details:      
 
Domain Number 3 Region: 398-482
Classification Level Classification E-value
Superfamily SH2 domain 1.17e-20
Family SH2 domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010537   Gene: ENSTNIG00000007720   Transcript: ENSTNIT00000010718
Sequence length 615
Comment pep:known_by_projection chromosome:TETRAODON8:16:1923989:1929500:1 gene:ENSTNIG00000007720 transcript:ENSTNIT00000010718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGAAVPGSPELSSSCPLPDWREFCELHARASAADFADKFQRFLTENPCYDSPGADVSFS
QHFAHHFLECFAHGQRRGRGQTAEAAPQRPPAGAQGLRPGTVAHSGGRLRRPPEARFKKG
FSLRNMSLCVVDGVKEMWHRRASPEPDAPPAARRANGGGGSGERWSQKLRLSRTPQSSKA
EMLEVQREGALRYMVGDDTNWPGAPTCRTGTRRRTRTRQFPLDFFVRPRSSKAKVSIPLS
AIVEVRTTMPLEMPDKDNTFVLKVENGAEYILETIDSLQKNSWVADIQDCIDPGDSGDDI
ELASCPHGQASRDGSTVAPCSCELLSEGAYRVPERPCPTAGEHYSTPSVRCREPPSTQHP
SHVPLERFLQSPEAQGPGSSAGTPGCCGSEGAKESEGDASLAGYPWFHGTLSRVRAAQLV
LAGGARSHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLENGQCHVHHLWFHTVSDLRH
FHAHPIPLESGGSADITLRSYVQAQAQGPEPPCWLTKRPSVSTPSCPGSHTHPGLAASVA
PPPDAQHPSSTSSSPTALPPLSRSDPGTGGAGGGLQSRSTSSERLLEAAGGASEDYHEAD
GTRRARAVENQYSFY
Download sequence
Identical sequences H3CQK3
ENSTNIP00000010537 99883.ENSTNIP00000010537 ENSTNIP00000010537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]