SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010597 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010597
Domain Number 1 Region: 424-747
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.14e-80
Family Ankyrin repeat 0.00000537
Further Details:      
 
Domain Number 2 Region: 17-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.35e-51
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000010597
Domain Number - Region: 290-333
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0863
Family Invasin/intimin cell-adhesion fragments 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010597   Gene: ENSTNIG00000007778   Transcript: ENSTNIT00000010778
Sequence length 752
Comment pep:known_by_projection chromosome:TETRAODON8:16:921218:925980:-1 gene:ENSTNIG00000007778 transcript:ENSTNIT00000010778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNFAKDEFEADWMKVAECRFGQLYQVKLKARREECVLKCFNLTLCSKSSYRKIIEEVSKV
AELKFKHIVTVYGACSEAAAVVMKHMSNGSLNNLLASHTLMWPKKFQMVYEISMGMNFLH
SIKPTILHLNLKTSNILLDDHLHVKISDFALIRWEEGMSKTLFMESLTARGNISYIPPET
FMQSSDPPGPAYDVYSFAIIIWEILTQQKPFAGLKGWSMTTVLLQVSQGRRPSLEIIPEQ
RPSECDQILCMMKQCWDQEPRRRPQFSDIVRTTEGLCEVQKIPGSIRGDKSNEEGQKSNY
PWLVSTINEASLKHVGRLTFPNHPSSLICLTAKLFEIVFEFLLRAINGKMLLPFKLPMTL
SEIPDPRPGKSTSIALMFKQQRSNVKLEGDNILSLLSRKDFGSFQQSLKREHIHTEYAGK
NSLLHYTITSKDTASVEHVLNLGADVNATTVRGYTALIIAVLHRLYDIISLLLEHGALVG
HGDEDQWTALHFAAQNGDDRTVRLLLDKGATPDTREKAGWMPLHLACQNGHEPVVRLLLS
RMSEEALEEREGHGRTPLHLACVYGHLSIAKLLLSQGADPTATDSSFSTPLHLSAAEGHN
RVVRQLLKSGVATDSADSSGYTPLHLAALKGHAGICRQLLSSQANLECVTLQGWRPMHLA
ALKGNKAIVVQLVSHGGSTNAKSEKGWTPLHLACHQSEPEVAAALLVAAADPNAMEDGKG
WSPLHFACNSVSFQCVLHLIAHRADVNVLSFE
Download sequence
Identical sequences H3CQR3
99883.ENSTNIP00000010597 ENSTNIP00000010597 ENSTNIP00000010597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]