SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010622 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010622
Domain Number 1 Region: 8-364
Classification Level Classification E-value
Superfamily TROVE domain-like 1.22e-112
Family TROVE domain-like 0.00000000156
Further Details:      
 
Domain Number 2 Region: 365-538
Classification Level Classification E-value
Superfamily vWA-like 4.45e-34
Family RoRNP C-terminal domain-like 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010622   Gene: ENSTNIG00000007802   Transcript: ENSTNIT00000010803
Sequence length 540
Comment pep:known_by_projection chromosome:TETRAODON8:15:3435010:3437707:-1 gene:ENSTNIG00000007802 transcript:ENSTNIT00000010803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAVSAVSPESNHTWSATGGGCQWEVTDRARLCRFLCYGGEGHVYTAREEENLSLQSAG
ALMSMLQEGRGAEVVEEIKKLAREGRAVRPGPSFFALALCSQHSELKTRQAAFKALREVC
RDPAQLFAFIQKKKELKEGMKCGIWGRALRKAVSDWYNEQDAMSLAAAVTKCKQSEGWSH
RDLLRLCHTKPANEAIALICKYATKGWKEVQVAYANKENSEEVDRVLSYLEAVEKVKHSC
DEMEVIHLIEEHKLEREQLLTDHLKSRQVWRALLKEMPLQAVLKFLGKMTASKILEPGNP
ETQAVCERIQCETALKKARIHPFSLLMSLEIYKRGQGYQGKKKWEPDSSVIKAMESAFYK
SFVNVEPAGRRFIVAVDVSTSLSSVVPGTPISTAIAAAAIAMMFVRTEADTEVLAYSEGT
VVPCAVTADMTLAEVTSELVKVPSGSTDCTLPVTWATERDRAADVFVVLTNNPLWPFSAS
PAETLQKHRRKTGASSKLVICGLTSNGSALADTEDRGLLSICGFDLGALSVIRNLAQDLI
Download sequence
Identical sequences H3CQT8
ENSTNIP00000010622 99883.ENSTNIP00000010622 ENSTNIP00000010622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]