SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010670 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010670
Domain Number 1 Region: 406-669
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-54
Family YWTD domain 0.0000000913
Further Details:      
 
Domain Number 2 Region: 322-399,673-721
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000091
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 202-239
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 4 Region: 27-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 5 Region: 112-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 238-278
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 7 Region: 152-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00043
Further Details:      
 
Domain Number 8 Region: 63-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 9 Region: 283-320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010670   Gene: ENSTNIG00000007850   Transcript: ENSTNIT00000010851
Sequence length 878
Comment pep:known_by_projection chromosome:TETRAODON8:15:3067663:3090326:-1 gene:ENSTNIG00000007850 transcript:ENSTNIT00000010851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKTESLWPRWLVTLLKISLSRKSLAKKTCAPAEFACLNGQCVPGRWRCDGEPECPDGSDE
AEETCSIQTCPPEKFDCGGSTNKCVSLSWRCDGEKDCENGADEEDCASDAKACPSGEFMC
ANRKCLATTYVCDGDDDCGDGSDELKCGSPLTCGPDHLRCNTSECVPLMWSCDGDPDCSD
SSDEGPERCGGDGAPYLLNRRANCSAGEFRCANGECVRLTWKCDGDPDCKDKSDESDCPL
LTCRPDEFQCGDGSCIHGTKQCNKVHDCVDHSDESGCVNATKCEGPLKFLCKNGECIDSS
RVCDSVKDCKDRSDEPKKECGLNECMINNGGCSHVCVDQPIGFDCQCPAGYQLLDRKTCG
DIDECENPDACSQICINYKGDFKCECYEGYEMDPVTKTCKAEGKSPYLLFTNRHEIRRID
LVKKDYSQVVSTQKNTVALDLDVANNRVFWCDRFHRKIYSAFIHEASDPSQQVPLVDSHL
HTPVGLALDWLQHNLYWTDSGDKSISVASVDATKRRVLISTDLSEPRSIALDPHHGFMYW
SDWGTRAKIEKAGMNGVDRQVLVADSIEWPNGITLDVANRRLYWVDSKLHLIASVDLNGA
HRRTHMSSAEMLGHPYALAVFEDRIYWTDRDRAAVFMANRLSFHDVQTLAENLNDPHDIV
VFHQLRQPQGVSERSNPCSVANGGCEYLCLKAPQITEHSPKYTCACPNGQDLGPDMRGCV
PETRANVPENIAPASGGASQADTTSHLSTAPSGAPEALTPLPTLKPMSSQESKALGSTAT
TTVVSTMPAGDSSISQHCVKLLSVFVPSTLGCLVCAGVYLVWRNWRRNSTKSMNFDNPVY
RKTTGEGEEDEIHIGRTDGMGHHTHHHPYPQGVNVGVV
Download sequence
Identical sequences H3CQY6
ENSTNIP00000010670 ENSTNIP00000010670 99883.ENSTNIP00000010670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]