SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010671 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010671
Domain Number 1 Region: 63-233
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-40
Family Ankyrin repeat 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010671   Gene: ENSTNIG00000007851   Transcript: ENSTNIT00000010852
Sequence length 240
Comment pep:known_by_projection chromosome:TETRAODON8:15:3061425:3064224:1 gene:ENSTNIG00000007851 transcript:ENSTNIT00000010852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FMTACRFLNDHMDNMDNPNNEMRKALIVLFQRWFSVAAEETSVPGDLAAYLREVRKATPT
LLAFLVNLADDNGNTVLHYSVSHCNYGIVGLLLETGACDVNLQNNAGYTAVMLAALTAPD
GPGGMEVVRKLMEMGNIHIRSKQTGQTALHLAVRHGRVVMVRLLLSYGADANIQDHQGTT
ALMFASERGHTHVARLLLERSHCDLSLTDKRGRTALSIAMQGSHTDTATLLQAHAKARAF
Download sequence
Identical sequences H3CQY7
99883.ENSTNIP00000010671 ENSTNIP00000010671 ENSTNIP00000010671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]