SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010721 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010721
Domain Number 1 Region: 427-553
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-30
Family Cadherin 0.0017
Further Details:      
 
Domain Number 2 Region: 208-334
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 105-212
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-21
Family Cadherin 0.0096
Further Details:      
 
Domain Number 4 Region: 543-648
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 5 Region: 321-431
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-19
Family Cadherin 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000010721
Domain Number - Region: 6-94
Classification Level Classification E-value
Superfamily Cadherin-like 0.0011
Family Cadherin 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010721   Gene: ENSTNIG00000007901   Transcript: ENSTNIT00000010902
Sequence length 994
Comment pep:known_by_projection chromosome:TETRAODON8:15:2546021:2549375:1 gene:ENSTNIG00000007901 transcript:ENSTNIT00000010902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQGKTMKYQTFEEDAPGTVIGNLARDISAASSPGISRSNFRMMKQFNSSYVRLRESDGQL
SIGERIDRERICKHTSQCLIAFDVVSFSKEQFKLIHVEVEVKDINDNTPEFPRKESSLEI
SENTAVGTRIPLDFAADDDVGSNYIQSYQISVNSHFSIDVLSRADGVKYAELVLMKELDR
ETQASYALELVAVDGGSPSRTGTTRVNVRVKDYNDNSPVFDRNSFSVDLPEDAPVGTLLL
DLNAEDPDEGLNGEVVYGFGHQVPTEIRQLFRVDRKSGRLTLESQIDFESKNTYEFDVQA
TDLGPNPSPAVCKIVVQVQDVNDNAPEISITPMTSITAGIAYITEAAARESFVALVSTSD
RDSGANGQVHCTLYGHDHFRLQQAYEDSFMIVSTSPLDREKIPEYNLTVVAEDLGSPPFR
TITQYTIRLTDENDNAPVFSKPVYEVSMVENNAPGAYIATVVARDLDTGLNGKVSYKLAD
SYFMGSPISTFVSLDPASGSLYALRSFNYEVMKQLELRITASDAGSPPLSGTANVYVKMV
DQNDNAPLITQPPLHNGSAEVLLPRDAPSGYVVTRVEARDADEGMNSAVSYALAAGELSV
FSINKDTGEIYLSQALNHDVDQTLSVTVTVSDGGRPALTSTATLHFLVIEGSPPSDRTLY
HQPGGQDQALAQWDLSVVIIVVLAGSCTLLLLAIILIATTCNRRKRDKGEEDSDSYGEKG
TLERGRNHVADNPLLPLHAAGDGAAFDGHSYSSQPGFASAHPGGGEACSASEDGSEVPCV
YDSDTNSKLRGNKHEGYSTLPGYGNGKEAVRPITIWKGNSYTTISARDPAFSGKDSGKGD
SDFNDSDSDVSGDTGPKKDGAGAPPTAGHNALWACTSECKVLGHSDRCWSPSAVRANAAP
SPAPTLSSFSSGSKTASLPRDPNRRDNYYQAHIPKTVGLQSVYEKVLHREYDYMVVTPPR
PVRVQEISDITLPVYTPTPTHRPASDAKSLSMSV
Download sequence
Identical sequences H3CR37
ENSTNIP00000010721 ENSTNIP00000010721 99883.ENSTNIP00000010721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]