SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010734 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010734
Domain Number 1 Region: 534-771
Classification Level Classification E-value
Superfamily vWA-like 7.93e-39
Family Integrin A (or I) domain 0.0041
Further Details:      
 
Domain Number 2 Region: 771-985
Classification Level Classification E-value
Superfamily vWA-like 1.17e-32
Family Integrin A (or I) domain 0.0028
Further Details:      
 
Domain Number 3 Region: 2-175
Classification Level Classification E-value
Superfamily vWA-like 6.38e-27
Family Integrin A (or I) domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010734   Gene: ENSTNIG00000007914   Transcript: ENSTNIT00000010915
Sequence length 985
Comment pep:known_by_projection chromosome:TETRAODON8:15:2464363:2471149:1 gene:ENSTNIG00000007914 transcript:ENSTNIT00000010915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECNIEVYFTIDTSETIALQESPPGSLVESIKDFTIEFVKRLADEEYRGAVRLSWKMGGLH
FSQEQRVFSRLGTKAQFINGISGIRYLGKGTYIDCALTNMTQEMTQSPSPFKPLRFAVVI
TDGHVTGNPCGGIKVSAERARDAGIRIFAVAASRNIDETGMREIANSPAMVYRDDFMAVD
LSQGRPIIHSQTIDRIIQTMKHLSYVECNSVSCLETPGPSGPKGHRGQKGAKGDSGGPGL
KGEKGRPGDPGIEGPIGQPGIKGEPGLKGDKGEMGAQGEKGGAGGLSGRDGTDGQKGKIG
RIGAPGCKGDPGDRGPDGHPGDVGETGPPGTDGEKGNTGRPGRSGPPGGPGDVGKKGDQG
SPGLPGDPGEQGNPGIPGDPGAPGEIGRRGDYGVKGSQGPGGIKGEKGESGPEGPRGLSG
ETGSKGSKGDNGLPGPRGSPGASGEPGKDGSRGDPGDVGPRGDPGPPGPKGDTGRPGFSY
PGSRGPTGDRGEIGKKGPQGSRGDCGQKGEPGDKGTPGDPGEPGHRGEPGRRGGRGEGGP
NGDPGPEGDPGLTECDVMNYIRETCGCCDCEKRCGALDIVFVIDSSESVGLTNFTLEKNF
VINTINRLGSLAKDPKSETGTRVGVVQYSHSGTFQAIRPDDPKIDSLTSFKEAVKQMEWI
AGGTWTPSALKYAYDNLIRDSRRAKASVSVVVITDGRFDPRDDDSLLTYLCSDPKVDVNA
IGIGDMFYQVEENEILRSIACQKDGKVLGMRRFADLVAEEFIDKIETVLCPEPVIICPDL
PCKSEPAVANCVRRPVDVVFMLDGSERMGLENHRRAKEFIDNVARRLNLASSSSDERDAR
IALLQYGSATEQRVEFPLTHNFTVISDSLDNLSYMDSSSALGSAIIYAINNIVTPKVGER
LARRHAELAFVFITDGITSREQLDEGVTAMRRGGGVPTVIAVGKDTDEEVLRKVALGDAT
AIFRADNYHMLNKSAFFERFIRWIC
Download sequence
Identical sequences H3CR50
ENSTNIP00000010734 99883.ENSTNIP00000010734 ENSTNIP00000010734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]