SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010771 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010771
Domain Number 1 Region: 77-185
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-26
Family Cadherin 0.00059
Further Details:      
 
Domain Number 2 Region: 294-415
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.005
Further Details:      
 
Domain Number 3 Region: 186-277
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-20
Family Cadherin 0.00086
Further Details:      
 
Domain Number 4 Region: 5-84
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000301
Family Cadherin 0.007
Further Details:      
 
Domain Number 5 Region: 402-512
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000117
Family Cadherin 0.0063
Further Details:      
 
Domain Number 6 Region: 612-692
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0000000212
Family Tetraviridae-like VP 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010771   Gene: ENSTNIG00000007950   Transcript: ENSTNIT00000010952
Sequence length 944
Comment pep:known_by_projection chromosome:TETRAODON8:15:2056413:2102642:-1 gene:ENSTNIG00000007950 transcript:ENSTNIT00000010952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLHTDMDRNDGRTKYVLRGEGAGSVFVIDEKTGNIHVTKPLDREEKDEYRLIATATDRLT
DRALEPSSQFIIRVQDINDNPPVFDEGPYSATVPEMANIGTSIIQVTATDADDPTYGNSA
KLVYTLVQGQQYFSVDPQTGILRTAVPDMDRETQDQYLVLLQAKDMGGHLGGLSGTTTVT
VKLSDVNDNPPRFTQSMWSFSVSELAIPGAEIGRISATDADLGENAKLEYTILEGESGDT
FNISGINQEAIITLNKAVDYESRSSYSFSVEVLNPVVDPRFLRRGPFKDAGCAVLDADEP
PRFSRARYHMDVSENCPPACTVGRSAVDPDTGLTNNIRFSIDPQSDPEALFRIAPDAGLI
TTAMELDREREHWHNITVIATQRDNPSQVSRVVVAIETLDLNDNAPELDRQYTTAMCDSS
SVGQVVQVLRAIDRDEGGNDSTVYFSIPPDSSVALNFSVRDSGGPTASLVLLSQLQPLSR
SASSTHTLFVPLVLRDGTSGLTSTGTVTVSVCPCLRGGARAGEKDKQTEGEWDWEREAVC
LPQQSTLPSPGLSTAALLAILACVATLLAVSALSLSLRRQKRDSLSPLEEDDVRENIITY
DDEGGGEADTAAFDIAALQSAPHSSRSRGYRTLDSRNVRYAHRSQDKAPNYSWAQNPAVE
FAAAGGPLYGRLCYSSHTLPVLRRTPGGPFEAGLAELGYRFPGGQPDHSLVIQNQGAMVG
PMESGAVYVAQADLSTGSQTGSRTGSRDGTVPQSASDGGTPRTSDSQERGGGTGTASNCT
EGSSSLDKVCDSATLPMVGRRASRTGLSSKGTSSGQADPDNSGSSGGGGSGGAGATGTDG
SNGDAAGGDIGAEGLLRHLGEGRSGDREQLCGGEAGQGGWRMEAARGAPGTGGPSLALRV
GEFLRLRLAQVTFDPSQPPYDSVQVYGLEGTGSRPAPSLTRGEG
Download sequence
Identical sequences H3CR87
99883.ENSTNIP00000010771 ENSTNIP00000010771 ENSTNIP00000010771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]