SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010792 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010792
Domain Number 1 Region: 11-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.69e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00041
Further Details:      
 
Domain Number 2 Region: 761-940
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.61e-37
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 317-495
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-30
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 4 Region: 947-1151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-30
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 5 Region: 125-315
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.63e-25
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 6 Region: 555-613
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000288
Family Fibrinogen C-terminal domain-like 0.0052
Further Details:      
 
Domain Number 7 Region: 526-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000104
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010792   Gene: ENSTNIG00000007970   Transcript: ENSTNIT00000010973
Sequence length 1278
Comment pep:known_by_projection chromosome:TETRAODON8:15:1407246:1428081:-1 gene:ENSTNIG00000007970 transcript:ENSTNIT00000010973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EECDGTLLSNLPPSSFRSSSQLSGSHAPGFAKLNRRDGAGGWSPLSSDRYQWLEVDLGQR
TEVTAVATQGRYGSSDWLTSYLLMFSDTGHNWKQHRQEDSLGSFPGNSNADSVVQYKLQQ
PVVARFLRLIPLGWNPNGRIGLRLEAYGCPYTSDVVSLDGSSGLTFRLDPQPRRTSADIP
SVPSVLSVLSVQFKTTRSSGVLLQAAGGGGPGLSLELHRGQLQLLLLQDPERTPPSEPRH
LASLGSLLDDQHWHRVVVVWRSSRLNLTVDKHTETVQVPPELGRRSILELNVGAVQESEQ
PNKSFRGCLENLLYNKLNLIQLAKRGAQQVSVVGNVTFSCAEPVSVAVTFPGPRSFLQLP
GATASSSGGTAVGFQFRTWNEAGLLLTFALAGEGGVAWLYLSEARLRLQIHRAGRVLLQL
SAGSALSDGQWHTVELSSRPGRLAVSVDGDEEGAAHPSSFIAEGPLFFGGCPAEGETQAC
RNTFGVFQGCMRLLSVGAQPVDFMTVQQRLLGNYSQLQIDMCGITDRCSPSPCEHGGRCS
QSWTGFRCNCSGSGYSGATCHSSAYERSCEAYKHAGGTSGLFYIDVDGSGPIRPQLVYCN
MTEENTWMEIQHNNTELTRLRPTPGRNQLSLHFDFFTEEEQLTAAISQSEHCEQELSYRC
RKSRLLNTPEGSPFSWWLGGRSPGRLRSYWGGAQPGSQQCACGLRGDCVDPQHYCNCDAD
RTEWAEDSGLLTHKESLPVRSLVLGDIWRPESEAAYRVGPLRCHGDKNFWNAAFFDKETS
YLHFPTFHGELSADISFLFKTTASSGVFLENLGIKDFIRIELSSSSQVLFSLDVGNGPLE
VHVDSAVPLNDNRWHRVRAERNIKEASLQLDDLAPATQEAPTDGHFHLQLNSQLFIGGTA
SRQKGFRGCIRSLQLNGAPLDLEERARITPGVRPGCPGHCGSYGSFCQNHGRCLERHAGF
RCDCARSAYAGVFCQTEVSASFQSGTSVSYSFQEPLDSPRNSSLVPSPTQPEVSARGENV
SLSFRTFQNPVLLLYVSSFSREFLALLINNDHLELCFRLDGRREAEVLRSRAGNLADGRL
HHVSVGRLSASVWLQVDEEAVEEFNLTSVGDLGAIKSLVLGRVQDPEGLDPEVARVASLG
FTGCLSAVRFNAISPLKAALLHPDSSPVVVTGPLLRSSCGSSASARPSAAEDAPRPPDRS
GSLGAGQPLVNAVRTDSALVGGIIAVAILVTAASLAAAAGFLYRRKEACQEPDGKAVKLE
DGPDSQKTSEENRKEYFI
Download sequence
Identical sequences H3CRA8
ENSTNIP00000010792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]