SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010795 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010795
Domain Number 1 Region: 147-389
Classification Level Classification E-value
Superfamily vWA-like 3.96e-85
Family Integrin A (or I) domain 0.000000206
Further Details:      
 
Domain Number 2 Region: 378-477
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-20
Family Integrin domains 0.001
Further Details:      
 
Domain Number 3 Region: 648-732
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.42e-16
Family Integrin beta tail domain 0.0026
Further Details:      
 
Domain Number 4 Region: 35-93
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000011
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 605-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family Integrin beta EGF-like domains 0.0029
Further Details:      
 
Domain Number 6 Region: 564-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Integrin beta EGF-like domains 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010795   Gene: ENSTNIG00000007973   Transcript: ENSTNIT00000010976
Sequence length 804
Comment pep:known_by_projection chromosome:TETRAODON8:15:1371005:1375581:1 gene:ENSTNIG00000007973 transcript:ENSTNIT00000010976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSLLRLFLLQMDLRLLLIAALSALLTVSWAQQEGSICIKANAQSCGECIQVSELCGWCTD
ISFLGEGESKSARCDDLESLKNRNCQTVDIENPRGSVVVNKDKPVTNRKNEPGELKPEQI
TQIQPQKLTLTLRSGEPLSFRLKFKRAEDYPIDLYYLMDLSFSMKDDLENVKNLGTDLMT
RMKKITSDFRIGFGSFVEKTVMPYISTTPARLINPCTSNQNCTSPFSYKNVLKLTDKGEE
FNRLVSQQQISGNLDSPEGGFDAIMQVAVCENEIGWRDVTRLLVFSTDAGFHFAGDGKLG
GIVLPNDGKCHLENNMYTMSHYYDYPSIAHLVQKLSDHNIQTIFAVTEEFQPVYKELKNL
IPKSAVGTLSSNSSNVINLIIDAYNALSSEVILENTKLPEGVSISYKSICKNGAEATGDN
GRKCSNISIGDEVFFQISVQADKCPADGRSETIKIKPQGFTEEVEIVLNFICDCPCASSG
EPRSPKCDSGNGIFECGACKCNQGRIGRVCECSKDDVHAEDLDANCRKDNGTDICSNNGD
CVCGTCECKKRLNPAESYSGKYCECDNFNCDRSNNMLCGGHGRCECRKCICDANYTGSAC
DCSMDTSTCMAKNGQLCNGRGSCECGTCKCTDVKFQGPTCEICPTCPGVCQEHKDCVLCR
AFPSEKPCANCSYFDLVKVADRDKLPQPTDQTFPLSHCKVRDENDCWVYYTFAIKNQTKM
VYVVEKPGCTEGPDIVPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAK
WDTGENPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences H3CRB1
ENSTNIP00000010795 ENSTNIP00000010795 99883.ENSTNIP00000010795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]