SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010824 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010824
Domain Number 1 Region: 55-808
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.08e-260
Family Motor proteins 0.000000000372
Further Details:      
 
Domain Number 2 Region: 1184-1281
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-28
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 3 Region: 1764-1833,1895-1929
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-18
Family Second domain of FERM 0.0077
Further Details:      
 
Domain Number 4 Region: 1365-1477
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-17
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 
Domain Number 5 Region: 1301-1357
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000472
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 6 Region: 1145-1185
Classification Level Classification E-value
Superfamily PH domain-like 0.000000476
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000010824
Domain Number - Region: 1674-1757
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000379
Family Ras-binding domain, RBD 0.037
Further Details:      
 
Domain Number - Region: 855-925,1187-1212
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.046
Family BAR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010824   Gene: ENSTNIG00000008002   Transcript: ENSTNIT00000011006
Sequence length 2037
Comment pep:known_by_projection chromosome:TETRAODON8:15:638008:655462:1 gene:ENSTNIG00000008002 transcript:ENSTNIT00000011006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRRAAGAAGPEMDNFFSEGERVWLREDKQCLPSTVSSCSGGVVVFATDYGQVYTYKQNAL
TRQKVQPMRLSSGGGVEDMAALEDLHDGAILHNLFLRYQQGHIYTYIGSILAAVNPYQLI
PALYDRQAVARYSRHHLGQIPPHIFAVANECYRSLWRRLQSQCVLISGESGAGKTESTKL
ILRFLSCMSQSSLEASCALRSSHVEEALLDSSPIMEAFGNARTVHNNNSSRFGKFVQLHF
GRRGNIQGGRILDCILVTNRVVRQNPGERNYHIFYALLAGTNSQQRAEALALAPPHSFHY
LRESGCVPEQTTNDRSTFHDVLKSMRTLQLTEEKIGQVLRLLAGVLHTGNVEFMTAGGAQ
VSSKSALSRTADLLGLDADQLAEVLTHRSMILRGEEISTPLTVEQALDSRDSMAMALYSR
CFNWIVSRINARIRGSEDFKSISILDIFGFENFEVNRFEQFNINYANEKLQEYFNKHIFS
LEQLEYNKEGLVWVDMDWMDNGECLDLIEKKLGLLALLNEESHFPKATDDTLLEKLHGQH
SKNPFYVKPRVAVHYFGVRHYAGEVVYDVRGMLQKNRDPFRDDVLNLLKESRLDFVYDLF
EHLHSRSHREALKSSSKHRRPTVVSQFKDSLHALMATLSTADPFFIRCIKPNAHKMPDQF
DPTLVLNQLRYSGMLETVKIRSRGFPVRRPFQDFCCRYRVLMQEQLVPGDPRRSCLQLLR
LHDDSGAEWQLGKTKVFLRESLERRLEQLRDLEVLKAAVIIQAHLLGYMARKRFRKVLRC
VVVIQKNLRALYWRRRFLLLRWAALTFQKRARGQIARRAYGRLKERRRKLEAERSAQVLH
LCPRAEEARRQEAPRRSEEAESVSQLAVEELEEARRSQEATKVEEILRLEREIQALQRQK
EQQELSLTQASLRRLHLLRDQELRRLEDEACRAAQNFLDSLNFHEIDECVRNIESSLGGG
GGEAEKEFGRRRSSREEEVDEGFGADEEAFKDSPNPSEHGHSDGQRTSGIRSSDDSSEED
PYANEAAPPPPLHQPLPPVPADSAYCCPPTSPEAPADPEVELIPPDEDSDYDQDDYDEGA
IATFSAGRDLWSPDHGGSVSTYASSGTYRFGSEGVQSSFEDSEDDLDRLDTDDELSYRRD
SVYSCVSLPYFHSFLHIKGGLMNTWKRRWCVLKDETFLWFRAKQEALKQGWLLKKGGGSS
TLSRRNWKRRWFVLRQSRLMYFENDGEEKMKGVLDVHAARDIVDATGRENGLDIVMPDRT
YHLIAESAEDASQWFSVLSQVHGSTEQEIREMSDEQANPQNAVGTLDVGLIDSVCASDNP
ERPNSFVMITANRVLQCNADTPEEMHHWITLLQRSKGDARVDGQEFLIRGWLHKEMKSSS
RGSLKLKKRWFLLTHSSLDYYRSAERHALKLGTLVLNSLCSVVQPDDKTFQETGYWTVVV
HGRRHSYRLYWKLLKEAARWADAIQNVIDGKAPIDTPTQQLIQDVKENCLNLEVVEQIYR
RNPILRHSHHPLHSPLLPLPYGDIHLPVPGTRSYSTLHLEALKVFSSLQHLEGVADPVPL
IQGILQTGQELRPLRDELYCQLIKQTTRPPQPGGSGNLWKILACMSCTFIPTRSILTYLR
FHLKRTRELWPGSEMDQYAAFALEALRRTRARENVPSQEEIRAILARQDMSTTVYCHGGG
SCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEHNHSSEKAIESRAVVADVLAKFER
LSASADEHNTGWKFYFKLYCFLDTDSVPRDSVEFAFMFEQAHEAVIRGQYPAPEETLQFL
AALRLQYLSGDHGPAPALPEMSQVFPMTRLRARVQNSAKSFAPGAAGSLAERSGASEKKR
SSFLEGTLRRSFRSGSLSRQKLEEENSLEAWLREEAAALRTSVLDKWRKLQGMSQEQAMV
KYMALVREWQGYGSTLFNVESADGAFPWELWLGISRQAVSVYKRGEAWPLEVFPYEQILS
FGAPLPNAYKIVVEGRDLLFQTQMVMDIAKLMKAYISMIVKKRCSNSQSVSSHGGAW
Download sequence
Identical sequences H3CRE0
ENSTNIP00000010824 99883.ENSTNIP00000010824 ENSTNIP00000010824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]