SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010851 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010851
Domain Number 1 Region: 322-552
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-19
Family Clostridium neurotoxins, the second last domain 0.026
Further Details:      
 
Domain Number 2 Region: 140-248
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000002
Family Cadherin 0.0036
Further Details:      
 
Domain Number 3 Region: 26-152
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000328
Family Cadherin 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010851   Gene: ENSTNIG00000008029   Transcript: ENSTNIT00000011033
Sequence length 947
Comment pep:known_by_projection chromosome:TETRAODON8:8:9244268:9254957:1 gene:ENSTNIG00000008029 transcript:ENSTNIT00000011033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLNFLSFFLLCLTSVASGNKANKHKPWIETEYQGIVMENDNTVLLNPPLFALDKDAPLHF
AALAGEICGFRVHNGPSGSGTVQFEAVVLDRSTGEGLVRSKEPLDCESQREHSFTIQAYD
CGEGPDGANSKKSHKATVHVRVNDVNEFSPVFVERRYEASVPEGRLFDRIVRVEALDADC
SPQYSQICFYDIITPNVPFAVDNDGNIKNTEPLDSKHQRVHTFWVTAFDCGKNRAQADAQ
VVITVKPSCKPGWMGWTKRVEYTPGSGSIPLFPGLHLETCEETVWNIQASVELQTGHIGK
GCDRDSYSDRSVRRLCGAVRGEVDLLPPPSPAANWTSALPTLPSSDSSLVFSFNGSNHVA
VVPDSVVSALSGDHFTLQLWMRRGGGNIQPATAQTRAGRKEEETIVCSTVRNDDSFSHYS
LSVHGCRLSLFYWPDVAAARPVKFLWKLEQVCDSEWHHLSLSVQFPSVTLYVDGVTFDPA
LIHDNGAIPNPAPRQRMSVGACWEPEEKQKEIQNNTISEVRYVGGYHGLLSGVTVRPGSV
EPHSVVECLYACREGLDFGDLETLGSGMKVHVNPSQSVLVLEGDDIESFNRAVQQVTYRN
SLRFATPGVRPLKLTTSLRCFNEESCLALKQLEGYLVVLQPDAPQISLSGVGPHLARPAP
EFEGPRGVSLFPELRIVCSLSHAVNTAAQGMEGGALMSDAVAHTLDGCEVQPLGEELNPE
REELLVDMDVVRERGLEIINTTAYIAITGAESISVYEDVLRSVRYRLAKGSARFERRFRL
SCSEMNGRYTSNELTLEVNFLHSLDNLYHPSNLLASQQQFLHPSHHAGELSGHTLPNPHR
NSVVPGAATVIIMVCVGFLVVMVILGVFRIRSIHRRGEGARGVSKEGGSQWDDSALTIIV
NPMESYESRMGISADTEGEGEEDEEAAESPEDAGDDQRIIIKKEGRE
Download sequence
Identical sequences H3CRG7
ENSTNIP00000010851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]